DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and mpd1

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_593653.1 Gene:mpd1 / 2542841 PomBaseID:SPAC13F5.05 Length:363 Species:Schizosaccharomyces pombe


Alignment Length:109 Identity:23/109 - (21%)
Similarity:47/109 - (43%) Gaps:6/109 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LKLRVDNFFETTE-DGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICN 116
            ::|...||.:..: .|...|.||.|.|..|.....|:..:|.:..|...:...:.:....:.:|:
pombe    34 IELNSKNFRKFVKAKGPSLVVFYAPWCGYCKKLVPTYQKLASNLHSLLPVTAVDCDADQNRAVCS 98

  Fly   117 DYELRYEPNLIWL---ENGEEVQ--QYDGDLTSPGIKIFVWEMI 155
            .|:::..|.:..:   ..|..:.  .|:||.:...::.||.:.|
pombe    99 QYQVQGFPTIKLVYPSSKGSSLSSTDYNGDRSYKSLQKFVSDSI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 20/103 (19%)
mpd1NP_593653.1 ER_PDI_fam 31..>257 CDD:273457 23/109 (21%)
PDI_a_MPD1_like 32..139 CDD:239300 21/104 (20%)

Return to query results.
Submit another query.