DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and pdi1

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_592871.1 Gene:pdi1 / 2541460 PomBaseID:SPAC1F5.02 Length:492 Species:Schizosaccharomyces pombe


Alignment Length:95 Identity:27/95 - (28%)
Similarity:43/95 - (45%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CTPGTILKLRVDNFFE-TTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKF 110
            |....:.|:..:...| .|.|....||||.|.|..|......:...|...: |:.|...|::|..
pombe    19 CASAEVPKVNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELE-KDGISLVEVDCTE 82

  Fly   111 AKTICNDYELRYEPNLIWLENGEEVQQYDG 140
            ...:|::|.:|..|.|...:||:::.||.|
pombe    83 EGDLCSEYSIRGYPTLNVFKNGKQISQYSG 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 26/91 (29%)
pdi1NP_592871.1 ER_PDI_fam 23..464 CDD:273457 26/91 (29%)

Return to query results.
Submit another query.