DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and PDILT

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_777584.1 Gene:PDILT / 204474 HGNCID:27338 Length:584 Species:Homo sapiens


Alignment Length:167 Identity:33/167 - (19%)
Similarity:65/167 - (38%) Gaps:29/167 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SLLIWSAQSDKSLSKQSGNVT----------TITNLSVKARSADQC----TPGTILKLRVDNF-- 60
            |:.|.:..||......|.::|          .::..:.|.:|:::.    ..|.:.:|...||  
Human   335 SVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNV 399

  Fly    61 --FETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICNDYEL--- 120
              |:..:|  .||.||.|....|........::.:.:::...|..|:::     ...||.:|   
Human   400 VVFDKEKD--VFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKID-----VTANDIQLMYL 457

  Fly   121 -RYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIR 156
             ||....::....::...|.|:.|..|...|:...|:
Human   458 DRYPFFRLFPSGSQQAVLYKGEHTLKGFSDFLESHIK 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 22/107 (21%)
PDILTNP_777584.1 YbbN 46..501 CDD:331940 33/167 (20%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 581..584
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.