DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Y73B6BL.12

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_500961.2 Gene:Y73B6BL.12 / 190648 WormBaseID:WBGene00022236 Length:136 Species:Caenorhabditis elegans


Alignment Length:96 Identity:24/96 - (25%)
Similarity:39/96 - (40%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PGTILKLRVDNFFETT---EDGTFFVKFYEPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKF 110
            |..::.|  .|.|.||   ....:.|.|:.|.|..|..|...:..:||....|.|  ||:::|..
 Worm    17 PTEVVSL--GNDFHTTVLDSSEPWIVDFFAPWCGHCIQFAPIYDRIAKELAGKVN--FAKIDCDQ 77

  Fly   111 AKTICNDYELRYEPNLI-------WLENGEE 134
            ...:|...::|..|.:.       |...|::
 Worm    78 WPGVCQGAQVRAYPTIRLYTGKTGWSRQGDQ 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 23/94 (24%)
Y73B6BL.12NP_500961.2 PDI_a_ERdj5_C 18..121 CDD:239302 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.