DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Y49E10.4

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_499613.1 Gene:Y49E10.4 / 176664 WormBaseID:WBGene00013030 Length:436 Species:Caenorhabditis elegans


Alignment Length:113 Identity:25/113 - (22%)
Similarity:48/113 - (42%) Gaps:10/113 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SVKARSADQCTPGTILKLRVDNFFETTEDG--TFFVKFYEPNCMGCHDFETTWTDMAKSFKSKEN 100
            |.|::.:|:  .|.::.|...||.:...:.  .:.|:|:.|.|..|...|..|...|:....:  
 Worm   144 SEKSKKSDK--KGKVVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEMGGR-- 204

  Fly   101 ICFAELNCKFAKTICNDYELRYEPNLIWLENG----EEVQQYDGDLTS 144
            :.|..|:....::|...:.:|..|.:.:...|    .:.:.|.|..||
 Worm   205 VKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQGGRTS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 21/100 (21%)
Y49E10.4NP_499613.1 PDI_a_P5 26..127 CDD:239299
PDI_a_P5 156..259 CDD:239299 21/99 (21%)
P5_C 269..405 CDD:239281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.