DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and ZK973.11

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_491361.1 Gene:ZK973.11 / 172039 WormBaseID:WBGene00022836 Length:447 Species:Caenorhabditis elegans


Alignment Length:147 Identity:38/147 - (25%)
Similarity:60/147 - (40%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PGTILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMAKSFK-SKENICFAELNCKFAK 112
            |..:|.|. |.|.:..::|.:||:||.|.|..|......|..:..:.. |...|...:|:|....
 Worm    27 PTAVLDLS-DKFLDVKDEGMWFVEFYAPWCAHCKRLHPVWDQVGHTLSDSNLPIRVGKLDCTRFP 90

  Fly   113 TICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIF-------VWEMIRRNETNK---SAAKR 167
            .:.|...::..|.:::..|| .|..|.|......:..|       :.|:|..|:..|   ||..:
 Worm    91 AVANKLSIQGYPTILFFRNG-HVIDYRGGREKEALVSFAKRCAAPIIEVINENQIEKVKLSARSQ 154

  Fly   168 P---YFHTKPIILFGWF 181
            |   :|.|....||..|
 Worm   155 PSYVFFGTSSGPLFDAF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 25/107 (23%)
ZK973.11NP_491361.1 ER_PDI_fam 29..>348 CDD:273457 37/145 (26%)
PDI_a_TMX3 29..132 CDD:239298 25/104 (24%)

Return to query results.
Submit another query.