DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and CaBP1

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_321144.3 Gene:CaBP1 / 1281205 VectorBaseID:AGAMI1_004965 Length:445 Species:Anopheles gambiae


Alignment Length:139 Identity:31/139 - (22%)
Similarity:55/139 - (39%) Gaps:22/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LFSLLIWSAQSDKSLSKQSGNVTTITNLSVKARSADQCTPGTILKLRVDNFFETTEDGTFFVKFY 74
            |..||::...|.::|...|.:|..:|..:...         |::|          .|..:.|:||
Mosquito    12 LVGLLLFVTGSSQALYSSSDDVVALTTANFDR---------TVVK----------SDEVWVVEFY 57

  Fly    75 EPNCMGCHDFETTWTDMAKSFKSKENICFAELNCKFAKTICNDYELRYEPNL-IWLENGEEVQQY 138
            .|.|..|.:....:...|.:.|..  |....:||:..:.:|..:.:|..|.: |:..|......|
Mosquito    58 APFCGHCRNLVPEYKKAATALKGV--IKVGGVNCEEEQGLCGQHGVRGYPTIKIFGANKRSPVDY 120

  Fly   139 DGDLTSPGI 147
            :|..|:..|
Mosquito   121 NGQRTAKDI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 23/98 (23%)
CaBP1XP_321144.3 PDI_a_P5 32..128 CDD:239299 24/116 (21%)
PDI_a_P5 168..272 CDD:239299
P5_C 282..411 CDD:239281
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.