DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and ERP27

DIOPT Version :10

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens


Alignment Length:69 Identity:17/69 - (24%)
Similarity:25/69 - (36%) Gaps:17/69 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 TICNDYELRYEPNLIWLENGEEVQQYDGDLTSPGIKIFVWEMIRRNETNKSAAKRPYFHTKPIIL 177
            |||          |..|.:.|::...|.|:.|    |...::.|..|.|.......|   .|:.:
Human   105 TIC----------LFRLVDNEQLNLEDEDIES----IDATKLSRFIEINSLHMVTEY---NPVTV 152

  Fly   178 FGWF 181
            .|.|
Human   153 IGLF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..151 CDD:469754 10/37 (27%)
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:463999 17/69 (25%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.