DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and Txndc5

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_663342.3 Gene:Txndc5 / 105245 MGIID:2145316 Length:417 Species:Mus musculus


Alignment Length:98 Identity:34/98 - (34%)
Similarity:54/98 - (55%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GTILKLRVDNFFETTEDGTFFVKFYEPNCMGCHDFETTWTDMA-KSFKSKENICFAELNCKFAKT 113
            ||:|.|...:|.:|...|..|||||.|.|..|.:...||.::: |.|....::..||::|...:.
Mouse   307 GTVLALTEKSFEDTIAQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERN 371

  Fly   114 ICNDYELRYEPNLIWLENGEEVQQYDG--DLTS 144
            :|:.|.:|..|.|:....||:|.:::|  ||.|
Mouse   372 VCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 33/97 (34%)
Txndc5NP_663342.3 PDI_a_ERp46 47..150 CDD:239303
ER_PDI_fam 52..417 CDD:273457 34/98 (35%)
PDI_a_ERp46 176..276 CDD:239303
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..302
PDI_a_ERp46 308..409 CDD:239303 33/97 (34%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2581
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.