DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18132 and PDIA6

DIOPT Version :9

Sequence 1:NP_608603.1 Gene:CG18132 / 33333 FlyBaseID:FBgn0031345 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001269633.1 Gene:PDIA6 / 10130 HGNCID:30168 Length:492 Species:Homo sapiens


Alignment Length:161 Identity:39/161 - (24%)
Similarity:67/161 - (41%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LSKQSGNVTTITNLSVKARSADQCTPGTILKLRVDNFFETTEDG--TFFVKFYEPNCMGCHDFET 86
            |..:||..:     |.|...:|..:...:::|..|:|.:...|.  .:.|:||.|.|..|.:.|.
Human   191 LGGRSGGYS-----SGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEP 250

  Fly    87 TWTDMAKSFK--SKENICFAELNCKFAKTICNDYELRYEPNLIWLENGEEVQQYDG-----DLTS 144
            .|...|...|  :|..:..|.::....:.:.:.|.:|..|.:...:.||....|||     |:.|
Human   251 EWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVS 315

  Fly   145 PGIKIF--------VWEMIRRNETNKSAAKR 167
            ..:.:|        :.|:|     |:..|||
Human   316 RALDLFSDNAPPPELLEII-----NEDIAKR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18132NP_608603.1 Thioredoxin_like 51..151 CDD:294274 27/116 (23%)
PDIA6NP_001269633.1 PDI_a_P5 78..180 CDD:239299
PDI_a_P5 213..318 CDD:239299 26/104 (25%)
P5_C 327..456 CDD:239281 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000934
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.