DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and PEP4

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_015171.1 Gene:PEP4 / 855949 SGDID:S000006075 Length:405 Species:Saccharomyces cerevisiae


Alignment Length:418 Identity:124/418 - (29%)
Similarity:202/418 - (48%) Gaps:41/418 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NIRVIILLFCLIVFVG--GKKVHRFRLERRSHRHHKIPHAHLHLQFRNALR---RKYGFTPLRTV 61
            :::.::.|..|:|...  ..|||:.::.:     |::......:.|...|.   :|| .|.....
Yeast     3 SLKALLPLALLLVSANQVAAKVHKAKIYK-----HELSDEMKEVTFEQHLAHLGQKY-LTQFEKA 61

  Fly    62 NAVNVTS-------ESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHC 117
            |...|.|       |.|..|    ||.|..:..::..:::|  .|:|.:..|||||:.||||:.|
Yeast    62 NPEVVFSREHPFFTEGGHDV----PLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNEC 122

  Fly   118 RFCIKTCGNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLV----N 178
            ........:|:..:::| |::::||.|:|.||:||::|.::.|.:..|||.|..|.....    .
Yeast   123 GSLACFLHSKYDHEASS-SYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPG 186

  Fly   179 ISDSCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSD---GGSMILGGSN 240
            ::.:...||||.|..:..:|:.|.||.|...|.|.|:::..|:|:|...|.|   ||....||.:
Yeast   187 LTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGID 251

  Fly   241 SSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDI 305
            .|.:.|.:|:..|....||..|.:.|.:..:.:.....|  |.:|||||||..|......||.:|
Yeast   252 ESKFKGDITWLPVRRKAYWEVKFEGIGLGDEYAELESHG--AAIDTGTSLITLPSGLAEMINAEI 314

  Fly   306 GAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCFSA-----FMDMLGLQY 365
            ||:...| ..||:.|.:...||.::|...|..|.:.|:.|.:.....|.||     |.:.:| ..
Yeast   315 GAKKGWT-GQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGSCISAITPMDFPEPVG-PL 377

  Fly   366 WILGDAFMRENYVEFDWARRRMGIAPAV 393
            .|:||||:|:.|..:|.....:|:|.|:
Yeast   378 AIVGDAFLRKYYSIYDLGNNAVGLAKAI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 104/326 (32%)
Asp 88..392 CDD:278455 102/317 (32%)
PEP4NP_015171.1 Proteinase_A_fungi 81..403 CDD:133155 105/330 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.970

Return to query results.
Submit another query.