DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and YPS5

DIOPT Version :10

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_011255.1 Gene:YPS5 / 852632 SGDID:S000003228 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:17/72 - (23%)
Similarity:32/72 - (44%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FTPLRTVNAVNVTSESGKGVVITEPLINSYDTNFFGV------VSVGDQSFTMQFDTGSSDFWVP 113
            |...:..:.:|:.::....|.....::|:...|..||      :....|:..:|.||||||..|.
Yeast    30 FPVQKFADIINIGTQDVSTVFKRNEVLNTTVINGIGVYVVKMEIGTPPQTVYLQLDTGSSDMIVN 94

  Fly   114 SSHCRFC 120
            ::...:|
Yeast    95 NADIAYC 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 Asp 88..392 CDD:394983 12/39 (31%)
YPS5NP_011255.1 pepsin_retropepsin_like 65..>100 CDD:472175 11/34 (32%)

Return to query results.
Submit another query.