DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and YPS3

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_013222.1 Gene:YPS3 / 850812 SGDID:S000004111 Length:508 Species:Saccharomyces cerevisiae


Alignment Length:351 Identity:88/351 - (25%)
Similarity:155/351 - (44%) Gaps:42/351 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EPLINSYDTNFFGV-VSVG--DQSFTMQFDTGSSDFWVPSSHCRFC--IKTCGN-KFFRKSNSKS 136
            |..:.:.:.:|:.| :::|  .|:.|:..||||:|.|||.....:|  :..|.. ..|.|:.|.:
Yeast    52 EKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGSVMDCDQYGVFDKTKSST 116

  Fly   137 FRSS-GTPFSITYGSGS-VKGIVASDNVGFGDLKIQNQGIGLVNISDSCSVFDGIAGFAFQQLSM 199
            |::: .:||...||.|: .:|....|.:.:.:|.:  .|:.....::|.|.| |:.|.....|.:
Yeast   117 FKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDL--SGLSFAVANESNSTF-GVLGIGLSTLEV 178

  Fly   200 TKSVPSFQQMIDQQLVEQ---PIF------------SFHLKSGSSDGGSMILGGSNSSLYYGPLT 249
            |.|  ....::|::..|.   |:|            |..|...|...||::.|..:.|.|.|.| 
Yeast   179 TYS--GKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQL- 240

  Fly   250 YT----NVTEAKYWSFKLDF-IAVHGKGSRSSR-------TGNKAIMDTGTSLIVGPVLEVLYIN 302
            ||    |:.:::.:...:.| :.:.|.|.::.:       |...|::|:||:|...|...|..:.
Yeast   241 YTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLA 305

  Fly   303 KDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYD-NFCFSAFMDMLGLQYW 366
            |.:.|.::||...|...|.|......:.|...|.........:.::.. ..|..|.:...|....
Yeast   306 KSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATA 370

  Fly   367 ILGDAFMRENYVEFDWARRRMGIAPA 392
            ||||:|:|..||.:|.....:.:|.|
Yeast   371 ILGDSFLRNAYVVYDLDNYEISLAQA 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 86/348 (25%)
Asp 88..392 CDD:278455 86/339 (25%)
YPS3NP_013222.1 SAP_like 61..396 CDD:133141 86/340 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.790

Return to query results.
Submit another query.