DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and AT1G69100

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001320489.1 Gene:AT1G69100 / 843242 AraportID:AT1G69100 Length:375 Species:Arabidopsis thaliana


Alignment Length:380 Identity:115/380 - (30%)
Similarity:171/380 - (45%) Gaps:86/380 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TVNAVNVTSESG----KGVVITEPLINSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPS---- 114
            |:| |..||..|    .|||            |:|.:|||.  |.|.:.|||||:|.||||    
plant    36 TLN-VGGTSFGGLKNFDGVV------------FYGEISVGSPPQKFNVVFDTGSTDLWVPSKEWP 87

  Fly   115 -----SHCRFCIKTCGNKFFRKSNSKSFR-SSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQG 173
                 .|.:          |.|..||:.| ..|...:|.|.:|||.||:|.|||..|.:.|::|.
plant    88 EETDHKHPK----------FDKDASKTCRLMKGGEVNIAYETGSVVGILAQDNVNVGGVVIKSQD 142

  Fly   174 IGLVNISDSC--SV-FDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSD----- 230
            :.|....|:.  || |||:.|...:......||..::.|:.|:|:.:||||.:|:....|     
plant   143 LFLARNPDTYFRSVKFDGVIGLGIKSSRAQGSVTVWENMVKQKLITKPIFSLYLRPHKGDGGEDP 207

  Fly   231 -GGSMILGGSNSSLYYGPLTYT--NVTEAKYWSFKLDFIAVHGKGSRS--SRTGNKAIMDTGTSL 290
             ||.::.||.:...:.|...|.  .:::.: |..|:..|.::||.:.:  ......|::|:|::.
plant   208 NGGQIMFGGFDPKQFKGEHVYVPMKLSDDR-WKIKMSKIYINGKPAINFCDDVECTAMVDSGSTD 271

  Fly   291 IVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYV--------- 346
            |.||...|..|.|:|||      ....:.||..|.||.|.|.|.||...:..|.||         
plant   272 IFGPDEAVGKIYKEIGA------TKVIIRCEQFPALPDIYFEIGGKHLRLTKHDYVEVKTNPKKR 330

  Fly   347 -----IRYDNFCFSAFMDMLGLQYWILGDAFMRENYVEFDWA---RRRMGIAPAV 393
                 ::..|          ..:.|:||:|||.:.:..||:.   ..|:|.|.|:
plant   331 CRLRIVKSKN----------RRKDWVLGEAFMTKFHTVFDYGDVKTPRIGFAEAI 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 104/354 (29%)
Asp 88..392 CDD:278455 105/345 (30%)
AT1G69100NP_001320489.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.