DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and PGA3

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001073275.1 Gene:PGA3 / 643834 HGNCID:8885 Length:388 Species:Homo sapiens


Alignment Length:386 Identity:133/386 - (34%)
Similarity:195/386 - (50%) Gaps:45/386 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HKIPHAHLHLQFRNALRR-------------KYGFTPLRTV----NAVNVTSESGKGVVITEPLI 81
            :|:|     |..:.:|||             |:...|.|..    .|..:..|        :||.
Human    18 YKVP-----LIRKKSLRRTLSERGLLKDFLKKHNLNPARKYFPQWKAPTLVDE--------QPLE 69

  Fly    82 NSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTCGNKFFRKSNSKSFRSSGTPF 144
            |..|..:||.:.:|.  |.||:.||||||:.||||.:|.....|..|: |...:|.:::|:....
Human    70 NYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYCSSLACTNHNR-FNPEDSSTYQSTSETV 133

  Fly   145 SITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDSC----SVFDGIAGFAFQQLSMTKSVPS 205
            |||||:||:.||:..|.|..|.:...||..||.......    :.||||.|.|:..:|.:.:.|.
Human   134 SITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPV 198

  Fly   206 FQQMIDQQLVEQPIFSFHLKSGSSDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHG 270
            |..:.:|.||.|.:||.:|.:....|..:|.||.:||.|.|.|.:..||...||...:|.|.::|
Human   199 FDNIWNQGLVSQDLFSVYLSADDQSGSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNG 263

  Fly   271 KGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAG 335
            :....:. |.:||:||||||:.||...:..|..||||..|...:: .|:|.:|..||.|||.|.|
Human   264 EAIACAE-GCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDM-VVSCSAISSLPDIVFTING 326

  Fly   336 KEFFVKPHTYVIRYDNFCFSAFMDMLGL-----QYWILGDAFMRENYVEFDWARRRMGIAP 391
            .::.|.|..|:::.:..|.|.|..| .|     :.|||||.|:|:.:..||.|..::|:||
Human   327 VQYPVPPSAYILQSEGSCISGFQGM-NLPTESGELWILGDVFIRQYFTVFDRANNQVGLAP 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 120/323 (37%)
Asp 88..392 CDD:278455 118/315 (37%)
PGA3NP_001073275.1 A1_Propeptide 17..45 CDD:285240 6/31 (19%)
pepsin_A 66..386 CDD:133145 120/323 (37%)
Asp 75..387 CDD:278455 118/316 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.