DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Napsa

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_113858.1 Gene:Napsa / 60575 RGDID:61940 Length:420 Species:Rattus norvegicus


Alignment Length:438 Identity:142/438 - (32%)
Similarity:204/438 - (46%) Gaps:97/438 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IILLFCLIVFVGGKKVHRFRLE----------RRSHRHHKIPHAHLHLQFRNALRRKYGFTPL-- 58
            ::||.|| |.:|       .||          ||.|..|:|                  |:||  
  Rat     6 LLLLLCL-VLLG-------NLEPAATLIRVPLRRIHPGHRI------------------FSPLYG 44

  Fly    59 --RTVNAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRF 119
              :........:..||...:  ||....:|.:||.:.:|  .|:||:.||||||:.||||:.|.|
  Rat    45 WEQRAELSRTPTSGGKTAFV--PLSKFMNTQYFGDIGLGTPPQNFTVVFDTGSSNLWVPSTRCHF 107

  Fly   120 CIKTC--GNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNIS-- 180
            ....|  .::|..|::| |||.:||.|:|.||:|.:.||::.||:..|         |:.|:|  
  Rat   108 FSLACWFHHRFNPKASS-SFRPNGTKFAIQYGTGRLSGILSRDNLTIG---------GIHNVSVT 162

  Fly   181 -----------DSCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLK--SGSSDGG 232
                       .:.:.||||.|..|..|::....|....:::|:|:|:|:|||:|.  |..||||
  Rat   163 FGEALWEPSLVFALARFDGILGLGFPTLAVGGVQPPLDALVEQRLLEKPVFSFYLNRDSEGSDGG 227

  Fly   233 SMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLE 297
            .::||||:...|..|||:..||...||...:..:.| |.|......|..||:|||||||.||..|
  Rat   228 ELVLGGSDPDHYVPPLTFIPVTIPAYWQVHMQSVKV-GTGLNLCAQGCGAILDTGTSLITGPSEE 291

  Fly   298 VLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRY----DNFCFSAFM 358
            :..:||.:|.....| ..|.:.|..||:||.:.|.:.|..|.:....|||:.    ...|     
  Rat   292 IRALNKAVGGFPLLT-GQYLIQCSKIPELPTVSFSLGGVWFNLTGQDYVIKILQSDVGLC----- 350

  Fly   359 DMLGLQ----------YWILGDAFMRENYVEFDWARR----RMGIAPA 392
             :||.|          .|||||.|:......||...:    |:|:|.|
  Rat   351 -LLGFQALDIPKPEGPLWILGDVFLGSYVAVFDRGDKNIGPRVGLARA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 122/349 (35%)
Asp 88..392 CDD:278455 120/340 (35%)
NapsaNP_113858.1 pepsin_retropepsin_like 69..395 CDD:299705 120/343 (35%)
Asp 73..397 CDD:278455 120/341 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.