DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and REN

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_000528.1 Gene:REN / 5972 HGNCID:9958 Length:406 Species:Homo sapiens


Alignment Length:356 Identity:111/356 - (31%)
Similarity:178/356 - (50%) Gaps:33/356 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PLRTVNAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRF 119
            |::.:...|.||    .|::|    |..||.::|.:.:|  .|:|.:.||||||:.|||||.|..
Human    63 PMKRLTLGNTTS----SVILT----NYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSR 119

  Fly   120 CIKTC-GNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVN----I 179
            ....| .:|.|..|:|.|::.:||..::.|.:|:|.|.::.|.:..|.:.: .|..|.|.    :
Human   120 LYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITV-TQMFGEVTEMPAL 183

  Fly   180 SDSCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSD----GGSMILGGSN 240
            ....:.|||:.|..|.:.::.:..|.|..:|.|.::::.:|||:....|.:    ||.::||||:
Human   184 PFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSD 248

  Fly   241 SSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDI 305
            ...|.|...|.|:.:...|..::..::| |..:.....|..|::|||.|.|.|....:..:.:.:
Human   249 PQHYEGNFHYINLIKTGVWQIQMKGVSV-GSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEAL 312

  Fly   306 GAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIR--YDN--FCFSAF--MDM---L 361
            ||:  |....|.|.|...|.||.|.|.:.|||:.:....||.:  |.:  .|..|.  ||:   .
Human   313 GAK--KRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPT 375

  Fly   362 GLQYWILGDAFMRENYVEFDWARRRMGIAPA 392
            | ..|.||..|:|:.|.|||....|:|.|.|
Human   376 G-PTWALGATFIRKFYTEFDRRNNRIGFALA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 103/332 (31%)
Asp 88..392 CDD:278455 101/323 (31%)
RENNP_000528.1 A1_Propeptide 33..>51 CDD:311771
renin_like 78..405 CDD:133154 105/335 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.