DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and pgc-like.1

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001025603.1 Gene:pgc-like.1 / 594991 XenbaseID:XB-GENE-964422 Length:385 Species:Xenopus tropicalis


Alignment Length:403 Identity:130/403 - (32%)
Similarity:207/403 - (51%) Gaps:41/403 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIILLFCLIVFVGGKKV--HRFRLERRSHRHHKIPHAHLHLQFRN-ALRRKYGFTPLRTVNAVNV 66
            ||:...||.:..|..:|  |:.:..|.:.:...:....:....|. |::.||           |:
 Frog     4 VILAFVCLQISEGLIRVPLHKSKTIRETMKEKGVLKEFMKTHKREPAMKYKY-----------NL 57

  Fly    67 TSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTCGN-KF 128
            .::.   .:..||:.  .|..::|.:|||  .|:|.:.||||||:.||.|::|:  ...|.| ..
 Frog    58 KNDF---AIAYEPMY--MDAAYYGQISVGTPPQNFMVLFDTGSSNLWVASTYCQ--SGACQNHPL 115

  Fly   129 FRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDS-----CSVFDG 188
            |..|.|.::.|....|||||||||:.|:...|.|....|.|.||.||| :|::.     .|.|:|
 Frog   116 FNPSQSSTYTSKNQQFSITYGSGSLTGVFGYDTVTVQGLSITNQEIGL-SINEPGTNFVYSSFEG 179

  Fly   189 IAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSDGGSMILGGSNSSLYYGPLTYTNV 253
            |.|.|:..|:...:....|.|:.|.|:..||||.::   ||..|.:|.||.:||||.|.:.:..|
 Frog   180 IFGMAYPALAAGGATTPMQGMLQQNLLTYPIFSVYM---SSQSGEVIFGGVDSSLYSGQIYWAPV 241

  Fly   254 TEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTV 318
            |:..||...:|..:::|:.:.....|.:|::||||||:..|...:....:.:||:.|: |..|.|
 Frog   242 TQELYWQIAIDEFSINGQATGWCSQGCQAMVDTGTSLLTVPQQFMGTFLQSLGAQQNQ-YGEYIV 305

  Fly   319 ACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCFSAFMDML------GLQYWILGDAFMRENY 377
            .|.::..||.|.|.|.|.:|.:.|..|:::.:.:| |..:::.      |..:|||||.|:|:.|
 Frog   306 NCNNVQSLPPISFTINGVQFPIPPSAYILQNNGYC-SVGVEVTYLPSQNGQPFWILGDVFLRQYY 369

  Fly   378 VEFDWARRRMGIA 390
            ..:|....|:|.|
 Frog   370 SVYDMGNNRVGFA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 117/327 (36%)
Asp 88..392 CDD:278455 114/317 (36%)
pgc-like.1NP_001025603.1 A1_Propeptide 17..45 CDD:369623 3/27 (11%)
pepsin_retropepsin_like 71..382 CDD:386101 114/318 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.