DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Cym

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_064476.2 Gene:Cym / 56825 RGDID:708486 Length:379 Species:Rattus norvegicus


Alignment Length:410 Identity:139/410 - (33%)
Similarity:208/410 - (50%) Gaps:50/410 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IRVIILLFCLIVFVGGKKVHRFRLERRSHRHHKIPHAHLHLQFRNAL-----------RRKYGFT 56
            :|..:||..::...            :||...:|| .|.....||.|           |.:|.|:
  Rat     1 MRCFVLLLAVLAIA------------QSHVVTRIP-LHKGKSLRNTLKEQGLLEDFLRRHQYEFS 52

  Fly    57 PLRTVNAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRF 119
                      ...|..|||.:|||.|..|:.:||::.||  .|.|.:.||||||:.||||.:|  
  Rat    53 ----------EKNSNIGVVASEPLTNYLDSEYFGLIYVGTPPQEFKVVFDTGSSELWVPSVYC-- 105

  Fly   120 CIKTCGN-KFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISD-- 181
            ..|.|.| ..|..|.|.:|::...|..:.||:|||:|.:|.|.|...|:.:.:|.:||.....  
  Rat   106 SSKVCRNHNRFDPSKSFTFQNLSKPLFVQYGTGSVEGFLAYDTVTVSDIVVPHQTVGLSTEEPGD 170

  Fly   182 --SCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSDGGSMI-LGGSNSSL 243
              :.|.||||.|.|:...:...|||.|..|:::.||.|.:||.::  ..:|.|||: ||..:.|.
  Rat   171 IFTYSPFDGILGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYM--SRNDQGSMLTLGAIDQSY 233

  Fly   244 YYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAE 308
            :.|.|.:..||...||.|.:|.|.::.: ..:.:.|..|::||||:|:.||..::|.|...|||.
  Rat   234 FIGSLHWVPVTVQGYWQFTVDRITINDE-VVACQGGCPAVLDTGTALLTGPGRDILNIQHAIGAV 297

  Fly   309 HNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCFSAFMDMLGLQYWILGDAFM 373
            ..: ::.:.:.|..:..:|.:||.|.|:||.:.|..|..::...|.|.|..  |.|.|||||.|:
  Rat   298 QGQ-HDQFDIDCWRLNFMPTVVFEINGREFPLPPSAYTNQFQGSCSSGFRH--GSQMWILGDVFI 359

  Fly   374 RENYVEFDWARRRMGIAPAV 393
            ||.|..||.|..|:|:|.|:
  Rat   360 REFYSVFDRANNRVGLAKAI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 119/320 (37%)
Asp 88..392 CDD:278455 115/311 (37%)
CymNP_064476.2 A1_Propeptide 19..47 CDD:400357 6/28 (21%)
pepsin_retropepsin_like 64..377 CDD:416259 119/320 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.