DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and PGC

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_002621.1 Gene:PGC / 5225 HGNCID:8890 Length:388 Species:Homo sapiens


Alignment Length:415 Identity:129/415 - (31%)
Similarity:201/415 - (48%) Gaps:58/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIILLFCL------IVFVGGKKVHRFRLERRSH-------RHHKIPHAHLHLQFRNALRRKYGFT 56
            ::::|.||      :|.|..||....|...:..       |.||...|.           ||.|.
Human     4 MVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAW-----------KYRFG 57

  Fly    57 PLRTVNAVNVTSESGKGVVITEPLINSY-DTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCR 118
            .|.               |..||:  :| |..:||.:|:|  .|:|.:.||||||:.||||.:|:
Human    58 DLS---------------VTYEPM--AYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQ 105

  Fly   119 FCIKTCGNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDSC 183
            ....|..:: |..|.|.::.::|..||:.|||||:.|....|.:....:::.||..||.......
Human   106 SQACTSHSR-FNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGT 169

  Fly   184 SV----FDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHL--KSGSSDGGSMILGGSNSS 242
            :.    ||||.|.|:..||:.::..:.|.|:.:..:..|:||.:|  :.||| ||:::.||.:||
Human   170 NFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSS-GGAVVFGGVDSS 233

  Fly   243 LYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGA 307
            ||.|.:.:..||:..||...::...:.|:.|.....|.:||:||||||:..|...:..:.:..||
Human   234 LYTGQIYWAPVTQELYWQIGIEEFLIGGQASGWCSEGCQAIVDTGTSLLTVPQQYMSALLQATGA 298

  Fly   308 EHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCF-----SAFMDMLGLQYWI 367
            :.:: |..:.|.|.||..||.:.|.|.|.||.:.|.:|::..:.:|.     :......|...||
Human   299 QEDE-YGQFLVNCNSIQNLPSLTFIINGVEFPLPPSSYILSNNGYCTVGVEPTYLSSQNGQPLWI 362

  Fly   368 LGDAFMRENYVEFDWARRRMGIAPA 392
            |||.|:|..|..:|....|:|.|.|
Human   363 LGDVFLRSYYSVYDLGNNRVGFATA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 110/326 (34%)
Asp 88..392 CDD:278455 107/316 (34%)
PGCNP_002621.1 A1_Propeptide 18..46 CDD:285240 6/27 (22%)
gastricsin 70..387 CDD:133144 108/319 (34%)
Asp 72..387 CDD:278455 107/317 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.