DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and pga4

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:369 Identity:128/369 - (34%)
Similarity:188/369 - (50%) Gaps:35/369 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FRNALRR---------KYGFTPLRTVNAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQS 98
            |||.|:|         ||.:.|..........|.:       |.|.|..|..::|.:|:|  .|.
 Frog    27 FRNRLQRLGLLGDYLKKYPYNPASKYFPTLAQSSA-------EVLQNYMDIEYYGTISIGTPPQE 84

  Fly    99 FTMQFDTGSSDFWVPSSHCRFCIKTCGNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVG 163
            ||:.|||||::.||||.:|.....|..|: |....|.:|:::.||.||.||:||:.|.:..|.:.
 Frog    85 FTVIFDTGSANLWVPSVYCSSSACTNHNR-FNPQQSTTFQATNTPVSIQYGTGSMSGFLGYDTLQ 148

  Fly   164 FGDLKIQNQGIGLVNISDS-------CSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFS 221
            .|::||.||..||   |:|       .|.||||.|.||..::.:::.|.|..|..|.|:.|.:||
 Frog   149 VGNIKISNQMFGL---SESEPGSFLYYSPFDGILGLAFPSIASSQATPVFDNMWSQGLIPQNLFS 210

  Fly   222 FHLKSGSSDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDT 286
            .:|.|....|..::.||.::|.|.|.|.:..:|...||...||.|:::|:....|:: .:||:||
 Frog   211 VYLSSDGQSGSYVLFGGVDTSYYSGSLNWVPLTAETYWQIILDSISINGQVIACSQS-CQAIVDT 274

  Fly   287 GTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDN 351
            ||||:.||...:..|...|||..:.. ..|.:.|.:|..:|.|||.|.|.::.:.|..||.:...
 Frog   275 GTSLMTGPTTPIANIQYYIGASQDSN-GQYVINCNNISNMPTIVFTINGVQYPLPPTAYVRQNQQ 338

  Fly   352 FCFSAFMDML----GLQYWILGDAFMRENYVEFDWARRRMGIAP 391
            .|.|.|..|.    ....|||||.|:|:.:|.||.....:.:||
 Frog   339 GCSSGFQAMTLPTNSGDLWILGDVFIRQYFVVFDRTNNYVAMAP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 117/325 (36%)
Asp 88..392 CDD:278455 115/317 (36%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 5/16 (31%)
pepsin_A 62..382 CDD:133145 117/325 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.