DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and XB964428

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_002933025.1 Gene:XB964428 / 496913 XenbaseID:XB-GENE-964429 Length:383 Species:Xenopus tropicalis


Alignment Length:411 Identity:126/411 - (30%)
Similarity:200/411 - (48%) Gaps:55/411 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIILLFCLIVFVGGKKV--HRFRLERRSHRHHKI------PHAHLHLQFRNALRRKYGFTPLRTV 61
            :|:.|.||.:..|..||  .||:..|...|.|.|      |.:..:.|:..|.            
 Frog     4 LILALVCLQLSEGIIKVPLKRFKSMREVMREHGIKAPIVDPASKYYNQYATAF------------ 56

  Fly    62 NAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTC 124
                            |||.|..|.:::|.:|:|  .|:|.:.||||||:.||.|::|:  .:.|
 Frog    57 ----------------EPLANYMDMSYYGEISIGTPPQNFLVLFDTGSSNLWVASTNCQ--SQAC 103

  Fly   125 GN-KFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDS-----C 183
            .| ..|..|.|.::.|:...||:.||:||:.||:..|.|...::.|..|..|| ::::.     .
 Frog   104 TNHPLFNPSQSSTYSSNQQQFSLQYGTGSLTGILGYDTVTIQNIAISQQEFGL-SVTEPGTNFVY 167

  Fly   184 SVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLK-SGSSDGGSMILGGSNSSLYYGP 247
            :.||||.|.|:..:::..:....|.|:.|.|:.:|:|.|:|. ..:..||.:..||.:.:.|.|.
 Frog   168 AQFDGILGLAYPSIAVGGATTVMQGMLQQNLLNEPVFGFYLSGENTQSGGEVAFGGVDQNYYTGQ 232

  Fly   248 LTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKT 312
            :.:|.||...||...:...:::|:.|.....|.:.|:||||||:..|......:.:||||:.::.
 Frog   233 IYWTPVTSETYWQIGIQGFSINGQASGWCSQGCQGIVDTGTSLLTAPQSIFASLMQDIGAQQDQN 297

  Fly   313 YNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDN-FCFSAFM-----DMLGLQYWILGDA 371
             ..|.|:|.||..||.|.|.|:|..|.:.|..||::..: :|....|     ...|...|||||.
 Frog   298 -GEYVVSCSSIQNLPTISFTISGVSFPLPPSAYVLQQSSGYCTIGIMPTYLSSQNGQPMWILGDV 361

  Fly   372 FMRENYVEFDWARRRMGIAPA 392
            |:|:.|..:|....::|.|.|
 Frog   362 FLRQYYSVYDLGNNQVGFASA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 108/327 (33%)
Asp 88..392 CDD:278455 104/318 (33%)
XB964428XP_002933025.1 A1_Propeptide 17..>36 CDD:369623 6/18 (33%)
pepsin_retropepsin_like 64..382 CDD:386101 105/321 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.