DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and CG5863

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster


Alignment Length:383 Identity:143/383 - (37%)
Similarity:193/383 - (50%) Gaps:38/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAVNVTSESGKGVVITEPLINSYDTNF 88
            |...||.||           ..|::|..||     ..|....|||.:|..   ||.|.|..:..:
  Fly    36 FMASRRQHR-----------AGRSSLLAKY-----NVVGGQEVTSRNGGA---TETLDNRLNLEY 81

  Fly    89 FGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTCGNKF-FRKSNSKSFRSSGTPFSITYGS 150
            .|.:|:|.  |.|.|.|||||::.||||:.|......|.:.. :..|.|.:|...|..|||.||:
  Fly    82 AGPISIGSPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFSIAYGT 146

  Fly   151 GSVKGIVASDNVGFGDLKIQNQGIGLVNISDSCSVFD----GIAGFAFQQLSMTKSVPSFQQMID 211
            ||:.|.:|.|.|..|.|.:|||..|:.......:..|    ||.|..|:.::.....|.|:.|.|
  Fly   147 GSLSGRLAQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGIKPLFESMCD 211

  Fly   212 QQLVEQPIFSFHLKSGSSD--GGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSR 274
            ||||::.:|||:||...|:  ||.::.||.:.:.:.|.|||..:|.|.||.|.||.|.|.|....
  Fly   212 QQLVDECVFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVAGTRIN 276

  Fly   275 SSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFF 339
            .:|   :||.||||||:..|..|.|.||..:|...... |.|.:.|..|..||.|||.|.|:.|.
  Fly   277 QNR---QAIADTGTSLLAAPPREYLIINSLLGGLPTSN-NEYLLNCSEIDSLPEIVFIIGGQRFG 337

  Fly   340 VKPHTYVIRYDN-----FCFSAFMDMLGLQYWILGDAFMRENYVEFDWARRRMGIAPA 392
            ::|..||:...|     .|.||| .::..::|||||.|:...|..||..:||:|.|||
  Fly   338 LQPRDYVMSATNDDGSSICLSAF-TLMDAEFWILGDVFIGRYYTAFDAGQRRIGFAPA 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 125/326 (38%)
Asp 88..392 CDD:278455 123/317 (39%)
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 125/325 (38%)
Asp 80..394 CDD:278455 123/318 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439942
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 1 0.950 - 0 Normalized mean entropy S1381
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.