DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and ren

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_998025.1 Gene:ren / 405786 ZFINID:ZDB-GENE-040630-3 Length:395 Species:Danio rerio


Alignment Length:412 Identity:118/412 - (28%)
Similarity:192/412 - (46%) Gaps:36/412 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNIRVIILLFCLIVFVGGKKVHRFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAV- 64
            |.|..:.||...:..:..|.:.|.:|:       |:|      ..|..| ::...||.:.::.: 
Zfish     1 MKIHCLTLLILSLSAISTKALWRVKLK-------KMP------SIRETL-KEMSVTPAQVLSEIM 51

  Fly    65 -NVTSESGKGVVITEPLINSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTC-G 125
             .....|........||||..||.:||.:|:|.  |.|.:.|||||::.||||..|......| .
Zfish    52 PKYQEPSPTNGTAPTPLINYLDTQYFGEISIGSPAQMFNVVFDTGSANLWVPSHSCSPLYTACFT 116

  Fly   126 NKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQN---QGIGLVNISDSCSVFD 187
            :..:..|.|.:...:||.|||.|.||:|:|.::.|.|..|.:.:..   :...|..|....:.||
Zfish   117 HNRYDASKSLTHIFNGTGFSIQYASGNVRGFLSEDVVVVGGIPVVQVFAEATALPAIPFILAKFD 181

  Fly   188 GIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSS--DGGSMILGGSNSSLYYGPLTY 250
            |:.|..:..:::....|.|.:::.|.::::.:||.:.....:  .||.::|||::.:.:.||..|
Zfish   182 GVLGMGYPNVAIDGITPVFDRIMSQHVLKENVFSVYYSRDPTHIPGGELVLGGTDPNYHTGPFHY 246

  Fly   251 TNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNL 315
            .|..|...|...:..::| |......:.|..|::|||:|.|.||...:..:.|.|||. ......
Zfish   247 INTKEQGKWEVIMKGVSV-GADILFCKDGCTAVIDTGSSYITGPASSISILMKTIGAV-ELAEGG 309

  Fly   316 YTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNF----CFSAF--MDM---LGLQYWILGDA 371
            |||:|..:..||.:.|.:.|:|:.:....|::....|    |...|  :|:   .| ..||||..
Zfish   310 YTVSCNVVRLLPTVAFHLGGQEYSLTDEDYILWQSEFGEDICTVTFKALDVPPPTG-PVWILGAN 373

  Fly   372 FMRENYVEFDWARRRMGIAPAV 393
            |:...|.|||....|:|.|.||
Zfish   374 FIARYYTEFDRGNNRIGFARAV 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 101/329 (31%)
Asp 88..392 CDD:278455 96/320 (30%)
renNP_998025.1 A1_Propeptide 23..>38 CDD:285240 6/28 (21%)
renin_like 68..394 CDD:133154 101/328 (31%)
Asp 75..394 CDD:278455 96/321 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.