DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and ctsd

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_988964.1 Gene:ctsd / 394561 XenbaseID:XB-GENE-5906945 Length:398 Species:Xenopus tropicalis


Alignment Length:418 Identity:141/418 - (33%)
Similarity:207/418 - (49%) Gaps:61/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILLFCLIVFVGGKKVH----RFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAVNVT 67
            :|..|.::..|...|.    :|...||:  ..:.....|.|....|..:...|     :|:.|.|
 Frog     9 LLALCCVMQPGSSLVRIPLKKFTSIRRA--MSETDQDALKLSGNEAATKYSAF-----LNSKNPT 66

  Fly    68 SESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTCG-NKFF 129
            .|:         |:|..|..::|.:.:|  .|.||:.||||||:.||||.||.|....|. :..:
 Frog    67 PET---------LLNYLDAQYYGEIGIGTPPQPFTVVFDTGSSNLWVPSIHCSFWDLACWLHHKY 122

  Fly   130 RKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQ----GIGLVNISDSCSVFDGIA 190
            ..|.|.::.::||.|:|.|||||:.|.::.|.|..|||.:..|    .|....|:...:.||||.
 Frog   123 DSSKSTTYINNGTEFAIQYGSGSLTGYLSKDTVTIGDLAVNGQFFAEAIKQPGITFVAAKFDGIL 187

  Fly   191 GFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSG--SSDGGSMILGGSNSSLYYGPLTYTNV 253
            |..:.::|:....|.|..:::|:||:..||||:|...  :..||.::|||::.:.|.|...|.||
 Frog   188 GMGYPKISVDGVPPVFDDIMEQKLVDSNIFSFYLNRNPDTLPGGELLLGGTDPAFYTGDFNYMNV 252

  Fly   254 TEAKYWSFKLDFIAVHGKGSRSS--RTGNKAIMDTGTSLIVGPVLEVLYINKDIGA------EHN 310
            |...||...:|.::|   |.|.|  :.|.:||:|||||||.|||.||..:.:.|||      |  
 Frog   253 TRKAYWQIHMDQLSV---GDRLSLCKDGCEAIVDTGTSLITGPVEEVTALQRAIGAIPLICGE-- 312

  Fly   311 KTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYD----NFCFSAFMDMLGLQ------- 364
                 |.:.|:|||.||:|.|...|:.:.:....||::..    ..|.|.|   |||.       
 Frog   313 -----YMILCDSIPSLPVISFTFGGRAYSLTGEQYVLKISKAGRTVCLSGF---LGLDIPPPAGP 369

  Fly   365 YWILGDAFMRENYVEFDWARRRMGIAPA 392
            .||:||.|:.:.|..||.|..|:|.|.|
 Frog   370 LWIIGDVFIGQYYTVFDRANDRVGFAKA 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 124/340 (36%)
Asp 88..392 CDD:278455 122/331 (37%)
ctsdNP_988964.1 A1_Propeptide 22..>39 CDD:311771 4/18 (22%)
pepsin_retropepsin_like 72..396 CDD:325019 123/336 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.