DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and CG17134

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster


Alignment Length:401 Identity:141/401 - (35%)
Similarity:209/401 - (52%) Gaps:37/401 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LFCLIVFVG----GKKVHRFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAVNVTSE 69
            |..|:|.||    ..|::|.:|:  .:::....|..:..: :..|..||.|.      |....|.
  Fly     4 LLVLLVLVGIGHSAAKLNRVQLQ--VNKNFTKTHGSVKAE-KTVLASKYSFL------AETSFSV 59

  Fly    70 SGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTC--GNKFFR 130
            |..|.  ||.|.||.:..::||:::|  :|.|.:.|||||::.||||:.|......|  .|| :.
  Fly    60 SSSGA--TENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNK-YD 121

  Fly   131 KSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDSCSV-----FDGIA 190
            .|.|.::.::|..|:|.||:||:.|.:::|.|....:.||||..|.. :|:..:.     |.||.
  Fly   122 SSASSTYVANGEEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEA-LSEPGTTFVDAPFAGIL 185

  Fly   191 GFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLK-SGSS-DGGSMILGGSNSSLYYGPLTYTNV 253
            |.||..:::....|.|..||.|.|:::|:.||:|| .|:: .||.:||||.:||||.|.|||..|
  Fly   186 GLAFSAIAVDGVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPV 250

  Fly   254 TEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTV 318
            :...||.||::.|..:|   .....|.:||.|||||||..|:.....||:.:||..|.....  |
  Fly   251 SVPAYWQFKVNTIKTNG---TLLCNGCQAIADTGTSLIAVPLAAYRKINRQLGATDNDGEAF--V 310

  Fly   319 ACESIPQLPIIVFGIAGKEFFVKPHTYVIRY----DNFCFSAFMDMLGLQYWILGDAFMRENYVE 379
            .|..:..||.:...|.|..|.:.|..|:::.    ..:|.|||..|.||.:|||||.|:.:.|..
  Fly   311 RCGRVSSLPKVNLNIGGTVFTLAPRDYIVKVTQNGQTYCMSAFTYMEGLSFWILGDVFIGKFYTV 375

  Fly   380 FDWARRRMGIA 390
            ||....|:|.|
  Fly   376 FDKGNERIGFA 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 123/328 (38%)
Asp 88..392 CDD:278455 119/318 (37%)
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 120/322 (37%)
Asp 75..388 CDD:278455 119/319 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455538
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.