DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and CG31928

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001259869.1 Gene:CG31928 / 326175 FlyBaseID:FBgn0051928 Length:418 Species:Drosophila melanogaster


Alignment Length:421 Identity:127/421 - (30%)
Similarity:214/421 - (50%) Gaps:48/421 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 IILLFCLIVFVGGKKVH----RFRLERRSHRHHKIPHAHLHLQFRN-ALRRKYGFTPLR--TVNA 63
            ::|::||      .:.|    |:|...:...|.:..|..:...|.| .||.|...:|..  .:::
  Fly    13 LVLIWCL------AQSHVESRRWRKSVQLKLHRETNHTKILSSFHNQKLRLKEKLSPTSDLAISS 71

  Fly    64 VNVTSESGKGVVITEPLINSYDTNFFGVVSVG---DQSFTMQFDTGSSDFWVPSSHCRFCIKTC- 124
            |:|...:    |..|.||||::|.::.....|   .|..|:..||.|::..|.||  .|..::| 
  Fly    72 VSVYQTT----VSKENLINSHNTEYYVTAGFGTPKSQPVTLLVDTASANLLVYSS--EFVKQSCL 130

  Fly   125 GNKFFRKSNSKSFRSSGTPFSITYGSGSV-KGIVASDNVGFGDLKIQNQGIGLVNI--SDSC--S 184
            .:..:..|.|::::::|:||.|.:.|..: .||:::|....|||.|:||....:|.  :|.|  |
  Fly   131 HHDGYNSSESQTYQANGSPFQIQFASQEILTGILSTDTFTLGDLVIKNQTFAEINSAPTDMCKRS 195

  Fly   185 VFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSD---GGSMILGGSNSSLYYG 246
            .||||.|..|.::::.........:::|.|:::||||.::...:||   ||.::||||:.:||.|
  Fly   196 NFDGIIGLGFSEIALNGVETPLDNILEQGLIDEPIFSLYVNRNASDASNGGVLLLGGSDPTLYSG 260

  Fly   247 PLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIG-AEHN 310
            .|||..|::..:|...:..:.:   ||:...:..:||.|.|||||:.|...:..|||.:| .|.:
  Fly   261 CLTYVPVSKVGFWQITVGQVEI---GSKKLCSNCQAIFDMGTSLIIVPCPALKIINKKLGIKETD 322

  Fly   311 KTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFC---FSAFMDMLGLQ-------- 364
            :...:|.:.|:.:..||.|||.|..|:|.:.|..|::.|...|   ||:..|..|.|        
  Fly   323 RKDGVYIIDCKKVSHLPKIVFNIGWKDFTLNPSDYILNYSGTCVSGFSSLSDCNGTQTNDDSEDL 387

  Fly   365 --YWILGDAFMRENYVEFDWARRRMGIAPAV 393
              .|:.||.|....:..||:..:.:|:||.|
  Fly   388 NNIWVFGDVFFGAIFTLFDFGLKLVGMAPKV 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 107/338 (32%)
Asp 88..392 CDD:278455 102/329 (31%)
CG31928NP_001259869.1 pepsin_retropepsin_like 84..416 CDD:299705 106/336 (32%)
Asp 91..416 CDD:278455 101/329 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439958
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.