DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Bace2

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001002802.1 Gene:Bace2 / 288227 RGDID:1303241 Length:514 Species:Rattus norvegicus


Alignment Length:374 Identity:95/374 - (25%)
Similarity:156/374 - (41%) Gaps:75/374 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NVTSESGKGVVITEPLINSYDTNFFGVVSVGDQSFTMQFDTGSSDFWV---PSSHCRFCIKTCGN 126
            |:..:||:|..: |.||.:           ..|...:..|||||:|.|   |.|:.        :
  Rat    79 NLQGDSGRGYYL-EMLIGT-----------PPQKVRILVDTGSSNFAVAGAPHSYI--------D 123

  Fly   127 KFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNV----GFGDLKIQNQGIGLVNISDSCSVF- 186
            .:|...:|.::.|.|...::.|..||..|.|..|.|    ||....:.|    :..|.:|.:.| 
  Rat   124 TYFDSESSSTYHSKGFEVTVKYTQGSWTGFVGEDLVTIPKGFNSSFLVN----IATIFESENFFL 184

  Fly   187 -----DGIAGFAFQQLSM-TKSVPSFQQMIDQQLVEQPIFSFHL------KSGS-SDGGSMILGG 238
                 :||.|.|:..|:. :.|:.:|...:..|.....|||..:      .:|| ::|||::|||
  Rat   185 PGIKWNGILGLAYAALAKPSSSLETFFDSLVAQAKIPDIFSMQMCGAGLPVAGSGTNGGSLVLGG 249

  Fly   239 SNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSR---SSRTGNKAIMDTGTSLIVGP------ 294
            ...|||.|.:.||.:.|..|:..::..:.:.|:...   .....:|||:|:||:|:..|      
  Rat   250 IEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDA 314

  Fly   295 VLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVF---------GIAGKEF--FVKPHTYV-- 346
            |:|.:.....|....:..:....:||.:..:.|...|         ..|.:.|  .:.|..|:  
  Rat   315 VVEAVARTSLIPEFSDGFWTGAQLACWTNSETPWAYFPKISIYLRDENASRSFRITILPQLYIQP 379

  Fly   347 -----IRYDNFCFSAFMDMLGLQYWILGDAFMRENYVEFDWARRRMGIA 390
                 ..|:.:.|........|   ::|...|...||.||.|:||:|.|
  Rat   380 MMGAGFNYECYRFGISSSTNAL---VIGATVMEGFYVVFDRAQRRVGFA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 91/361 (25%)
Asp 88..392 CDD:278455 88/351 (25%)
Bace2NP_001002802.1 beta_secretase_like 85..446 CDD:133140 93/368 (25%)
Asp 88..425 CDD:278455 90/363 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.