DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and asp-16

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_741674.1 Gene:asp-16 / 260226 WormBaseID:WBGene00012682 Length:395 Species:Caenorhabditis elegans


Alignment Length:340 Identity:89/340 - (26%)
Similarity:159/340 - (46%) Gaps:29/340 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 TEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHC--RFCIKTCGNKF----FRKSN 133
            ::|||:.||..:...::||  .|..::..||.|::.||..:.|  :.|....|:.:    |..:.
 Worm    57 SQPLIDYYDDMYLANITVGTPPQPASVVLDTASANLWVIDAACNSQACNGNPGSGYTKQKFNPNK 121

  Fly   134 SKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGL-VNISD--SCSVFDGIAGFAFQ 195
            |.:|......|||.||||:..|.:.:|.:..|.|.::.|..|: .|:..  .....|||.|..:.
 Worm   122 SSTFVKGTRRFSIQYGSGTSSGYLGTDVLQLGGLTVKAQEFGVATNLGSVLGSEPMDGIFGLGWP 186

  Fly   196 QLSMTKSVPSFQQMIDQQLVEQPIFSFHLK-----SGSSDGGSMILGGSNSSLYYGPLTYTNVTE 255
            .:|:.:..|..|.:|.|:.::.|:||..:.     |....||.:..|..::......:.|..::.
 Worm   187 AISVDQVTPPMQNLISQKQLDAPLFSIWVDRKLQVSQGGTGGLITYGAVDTKNCDAQVNYVALSS 251

  Fly   256 AKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSL--IVGPVLEVLYINKDIGAEHNKTYNLYTV 318
            ..||.|.:|.:|:   |:.:.....:||.|||::.  :..|||..  |.:...|.::..|.:||:
 Worm   252 KTYWQFPMDGVAI---GNYAMMKQEQAISDTGSAWLGLPNPVLNA--IVQQTKATYDWNYEIYTL 311

  Fly   319 ACESIPQLPIIVFGIAGKEFFVKPHTYVIRY---DNFCFSAFMDMLGLQY---WILGDAFMRENY 377
            .|.::...|.:||.|.|.::.||...|::..   :..|..|.:......:   ::||..|:|:..
 Worm   312 DCSTMQTQPDLVFTIGGMQYPVKSIEYILDLGLGNGRCVLAMLSYSNTGFGPSYVLGHVFIRQFC 376

  Fly   378 VEFDWARRRMGIAPA 392
            ..:|....|:|.|.|
 Worm   377 NVYDIGNARIGFANA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 87/336 (26%)
Asp 88..392 CDD:278455 83/327 (25%)
asp-16NP_741674.1 Asp 68..391 CDD:365818 83/327 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162078
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D270366at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.