DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Pgc

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_579818.1 Gene:Pgc / 24864 RGDID:3943 Length:392 Species:Rattus norvegicus


Alignment Length:383 Identity:121/383 - (31%)
Similarity:195/383 - (50%) Gaps:58/383 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PLRTVNAVNVTSESGKGV-------------------------VITEPLINSY-DTNFFGVVSVG 95
            |||.:.::..|.:. :||                         |:.||:  :| |.::||.:|:|
  Rat    22 PLRKMKSIRETMKE-QGVLKDFLKTHKYDPGQKYHFGNFGDYSVLYEPM--AYMDASYFGEISIG 83

  Fly    96 --DQSFTMQFDTGSSDFWVPSSHCRFCIKTC-GNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIV 157
              .|:|.:.||||||:.||.|.:|:  .:.| .:..|..|.|.::.:.|..||:.||:||:.|..
  Rat    84 TPPQNFLVLFDTGSSNLWVSSVYCQ--SEACTTHARFNPSKSSTYYTEGQTFSLQYGTGSLTGFF 146

  Fly   158 ASDNVGFGDLKIQNQGIGLVNISDSCSV----FDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQP 218
            ..|.:....:::.||..||.......:.    ||||.|.|:..||...:..:.|.|:.:..:.||
  Rat   147 GYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPGLSSGGATTALQGMLGEGALSQP 211

  Fly   219 IFSFHLKS-GSSDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSR-SSRTGNK 281
            :|..:|.| ..|:||.::.||.:.:||.|.:|:..||:..||...:|...:..:.|. .|..|.:
  Rat   212 LFGVYLGSQQGSNGGQIVFGGVDKNLYTGEITWVPVTQELYWQITIDDFLIGDQASGWCSSQGCQ 276

  Fly   282 AIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYV 346
            .|:||||||:|.|...:..:.:.|||:..: |..|.|:|:|:..||.:.|.:.|.:|.:.|.:|:
  Rat   277 GIVDTGTSLLVMPAQYLSELLQTIGAQEGE-YGEYFVSCDSVSSLPTLSFVLNGVQFPLSPSSYI 340

  Fly   347 IRYDNFCFSAFMDMLGLQ-----------YWILGDAFMRENYVEFDWARRRMGIAPAV 393
            |:.||||      |:||:           .|||||.|:|..|..||....::|:|.:|
  Rat   341 IQEDNFC------MVGLESISLTSESGQPLWILGDVFLRSYYAIFDMGNNKVGLATSV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 112/333 (34%)
Asp 88..392 CDD:278455 109/323 (34%)
PgcNP_579818.1 A1_Propeptide 18..46 CDD:400357 6/24 (25%)
pepsin_retropepsin_like 73..391 CDD:416259 110/326 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.