DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Ren

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_036774.4 Gene:Ren / 24715 RGDID:3554 Length:402 Species:Rattus norvegicus


Alignment Length:361 Identity:112/361 - (31%)
Similarity:183/361 - (50%) Gaps:33/361 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RTVNAVNVTSESGKGVV------ITEPLI--NSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVP 113
            |.|:...:::|.|:.:.      :|.|::  |..||.::|.:.:|  .|:|.:.|||||::.|||
  Rat    47 RGVDMTRISAEWGEFIKKSSFTNVTSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVP 111

  Fly   114 SSHCRFCIKTCG-NKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLV 177
            |:.|......|. :..:..|.|.|:..:||.|:|.||||.|||.::.|.|..|.: |..|..|.|
  Rat   112 STKCGPLYTACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVGGI-IVTQTFGEV 175

  Fly   178 N----ISDSCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFS-FHLKSGSSDGGSMILG 237
            .    |....:.|||:.|..|...::...:|.|..::.|:::::.:|| ::.:.....||.::||
  Rat   176 TELPLIPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRESHLLGGEVVLG 240

  Fly   238 GSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYIN 302
            ||:...|.|...|.::::|..|...:..::| |..:.....|..|::|||||.|.||...:..|.
  Rat   241 GSDPQHYQGNFHYVSISKAGSWQITMKGVSV-GPATLLCEEGCMAVVDTGTSYISGPTSSLQLIM 304

  Fly   303 KDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYV----IRYDNFCFSAFMDMLGL 363
            :.:|.:..:..| |.|.|..:|.||.|.|.:.|:.:.:....||    .|.|:.|..|   :.||
  Rat   305 QALGVKEKRANN-YVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCILA---LQGL 365

  Fly   364 Q-------YWILGDAFMRENYVEFDWARRRMGIAPA 392
            .       .|:||..|:|:.|.|||....|:|.|.|
  Rat   366 DIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALA 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 105/333 (32%)
Asp 88..392 CDD:278455 102/322 (32%)
RenNP_036774.4 A1_Propeptide 31..64 CDD:400357 4/16 (25%)
renin_like 76..401 CDD:133154 105/330 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.980

Return to query results.
Submit another query.