DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and BACE1

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens


Alignment Length:376 Identity:86/376 - (22%)
Similarity:154/376 - (40%) Gaps:75/376 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 NVTSESGKGVVITEPLINSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTCGNK 127
            |:..:||:|              ::..::||.  |:..:..|||||:|.|.::...|.     ::
Human    66 NLRGKSGQG--------------YYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFL-----HR 111

  Fly   128 FFRKSNSKSFRSSGTPFSITYGSGSVKGIVASD--NVGFGDLKIQNQGIGLVNISD----SCSVF 186
            ::::..|.::|.......:.|..|..:|.:.:|  ::..|........|..:..||    :.|.:
Human   112 YYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNW 176

  Fly   187 DGIAGFAFQQLSMTKS--VPSFQQMIDQQLVEQPIFSFHLKSG----------SSDGGSMILGGS 239
            :||.|.|:.:::....  .|.|..::.|..|.. :||..|...          :|.|||||:||.
Human   177 EGILGLAYAEIARPDDSLEPFFDSLVKQTHVPN-LFSLQLCGAGFPLNQSEVLASVGGSMIIGGI 240

  Fly   240 NSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSR---SSRTGNKAIMDTGTSLIVGP--VLEVL 299
            :.|||.|.|.||.:....|:...:..:.::|:..:   .....:|:|:|:||:.:..|  |.|..
Human   241 DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAA 305

  Fly   300 YINKDIGA--------------EHNKTYNLYTVACESIPQLPIIVFGIAGKEFF---VKPHTYV- 346
            .  |.|.|              |....:...|......|.:.:.:.|....:.|   :.|..|: 
Human   306 V--KSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLR 368

  Fly   347 -------IRYDNFCFSAFMDMLGLQYWILGDAFMRENYVEFDWARRRMGIA 390
                   .:.|.:.|:......|.   ::|...|...||.||.||:|:|.|
Human   369 PVEDVATSQDDCYKFAISQSSTGT---VMGAVIMEGFYVVFDRARKRIGFA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 82/363 (23%)
Asp 88..392 CDD:278455 82/353 (23%)
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58
beta_secretase_like 72..437 CDD:133140 84/370 (23%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.