DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Cym

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001104613.1 Gene:Cym / 229697 MGIID:2684977 Length:379 Species:Mus musculus


Alignment Length:410 Identity:140/410 - (34%)
Similarity:209/410 - (50%) Gaps:53/410 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVIILLFCLIVFVGGKKVHRFRLERRSHRHHKIPHAHLHLQFRNAL-----------RRKYGFTP 57
            |.::||..|.:             .:||...:|| .|.....||.|           |::|.|: 
Mouse     3 RFVLLLAALAI-------------SQSHVVTRIP-LHKGKSLRNTLKEQGLLEDFLSRQQYEFS- 52

  Fly    58 LRTVNAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFC 120
                     ...|..|||.:|||||..|:.:||.:.:|  .|.||:.||||||:.||||.:|.  
Mouse    53 ---------EKNSRIGVVASEPLINYLDSEYFGTIYIGTPPQEFTVVFDTGSSELWVPSVYCN-- 106

  Fly   121 IKTCGNKF-FRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISD--- 181
            .|.|.|.. |..|.|.:|::...|..:.||:|.::|.:|.|.|...|:.:.:|.:||.....   
Mouse   107 SKVCRNHHRFDPSKSITFQNLSKPLFVQYGTGRMEGFLAYDTVTVSDIVVSHQTVGLSTQEPGDI 171

  Fly   182 -SCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSDGGSMILGGSNSSLYY 245
             :.|.||||.|.|:...:...|||.|..|:::.||.|.:||.:: |.:..|..:.||..:.|.:.
Mouse   172 FTYSPFDGILGLAYPTFASKYSVPIFDNMMNRHLVAQDLFSVYM-SRNEQGSMLTLGAIDQSYFI 235

  Fly   246 GPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGA--E 308
            |.|.:..||...||.|.:|.|.::|: ..:.:.|..|::||||:|:.||..::|.|.:.|||  .
Mouse   236 GSLHWVPVTVQGYWQFTVDRITINGE-VVACQGGCPAVLDTGTALLTGPGRDILNIQQVIGAVQG 299

  Fly   309 HNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCFSAFMDMLGLQYWILGDAFM 373
            ||..::   :.|..:..:|.:||.|.|:||.:.|:.|..:...||.|.|..  |...|||||.|:
Mouse   300 HNDQFD---IDCWRLDIMPTVVFEIHGREFPLPPYAYTNQVQGFCSSGFKQ--GSHMWILGDVFI 359

  Fly   374 RENYVEFDWARRRMGIAPAV 393
            ||.|..||.|..|:|:|.|:
Mouse   360 REFYSVFDRANNRVGLAKAI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 119/321 (37%)
Asp 88..392 CDD:278455 114/312 (37%)
CymNP_001104613.1 A1_Propeptide 19..44 CDD:285240 6/25 (24%)
pepsin_retropepsin_like 64..377 CDD:299705 119/321 (37%)
Asp 73..378 CDD:278455 114/313 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1381
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.