DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Ren2

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_112470.2 Gene:Ren2 / 19702 MGIID:97899 Length:424 Species:Mus musculus


Alignment Length:422 Identity:118/422 - (27%)
Similarity:199/422 - (47%) Gaps:57/422 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNIRVIILLF--CLIVFVGGKKVHRFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNA 63
            |.:..::||:  |......|....|..|:       |:|.....|:.|                .
Mouse    29 MPLWALLLLWSPCTFSLPTGTTFERIPLK-------KMPSVREILEER----------------G 70

  Fly    64 VNVTSESGKGVVITE---------PLI--NSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSS 115
            |::|..|.:..|.|:         |::  |..::.::|.:.:|  .|:|.:.|||||::.||||:
Mouse    71 VDMTRLSAEWDVFTKRSSLTDLISPVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPST 135

  Fly   116 HCRFCIKTCG-NKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVN- 178
            .|......|| :..:..|:|.|:..:|..|:|.||||.|||.::.|:|..|.:.: .|..|.|. 
Mouse   136 KCSRLYLACGIHSLYESSDSSSYMENGDDFTIHYGSGRVKGFLSQDSVTVGGITV-TQTFGEVTE 199

  Fly   179 ---ISDSCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSS-DGGSMILGGS 239
               |....:.|||:.|..|...::....|.|..::.|.::::.:||.:...|.. .||.::||||
Mouse   200 LPLIPFMLAQFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEKVFSVYYNRGPHLLGGEVVLGGS 264

  Fly   240 NSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKD 304
            :...|.|...|.::::...|...:..::| |..:.....|.:.::|||:|.|..|...:..|.:.
Mouse   265 DPEHYQGDFHYVSLSKTDSWQITMKGVSV-GSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQA 328

  Fly   305 IGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRY----DNFCFSAF--MDM--- 360
            :||:..:.:. |.|:|..:|.||.|.|.:.|:.:.:....||::|    |..|..|.  ||:   
Mouse   329 LGAKEKRLHE-YVVSCSQVPTLPDISFNLGGRAYTLSSTDYVLQYPNRRDKLCTVALHAMDIPPP 392

  Fly   361 LGLQYWILGDAFMRENYVEFDWARRRMGIAPA 392
            .| ..|:||..|:|:.|.|||....|:|.|.|
Mouse   393 TG-PVWVLGATFIRKFYTEFDRHNNRIGFALA 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 100/340 (29%)
Asp 88..392 CDD:278455 99/320 (31%)
Ren2NP_112470.2 A1_Propeptide 51..76 CDD:285240 8/47 (17%)
renin_like 98..423 CDD:133154 100/328 (30%)
Asp 105..423 CDD:278455 99/321 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.120

Return to query results.
Submit another query.