DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and asp-7

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_503826.2 Gene:asp-7 / 186613 WormBaseID:WBGene00019104 Length:380 Species:Caenorhabditis elegans


Alignment Length:334 Identity:91/334 - (27%)
Similarity:152/334 - (45%) Gaps:26/334 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EPLINSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTCGNKFFRKSN---SKSF 137
            |.:.:.:|..:...|.:|.  |.|.:..||.||:.||....|:  .::|.....|:.|   |.:|
 Worm    52 ESIYDHFDEYYTVSVRIGTPAQHFEVALDTTSSNLWVFGVECK--SQSCQGHRIREYNRTASSTF 114

  Fly   138 RSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQ--GIGLVNISDSCSVFDGIAGFAFQQLSMT 200
            .:..:.|.:.:..|.|.|.:..||:.|...|||||  |||......|...|||:.|..:...::.
 Worm   115 IAGTSNFVLPFNDGDVSGDLGKDNIQFAGSKIQNQDFGIGTDATRLSGVTFDGVLGLGWPATALN 179

  Fly   201 KSVPSFQQMIDQQLVEQPIFSFHLKSGS----SDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSF 261
            .:..:.|.::.|  ::||:|:.:....|    :.||.:..|..:::.....:.|..:.....||:
 Worm   180 GTSTTMQNLLPQ--LDQPLFTTYFTKSSVHNGTVGGEITFGAIDTTHCQSQINYVRLAYDSLWSY 242

  Fly   262 KLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQL 326
            .:|..:.   |:.|....:.||.||.:|....|.|.:..|....||:::..:..||:.|.|...|
 Worm   243 SIDGFSF---GNYSRNQTDTAIPDTTSSYTGVPNLVLAEIVIATGAQYDWNHQAYTLPCSSTATL 304

  Fly   327 PIIVFGIAGKEFFVKPHTYVIRY---DNFC----FSAFMDMLGLQYWILGDAFMRENYVEFDWAR 384
            |.:||.|.|..:.|:...||:..   :..|    |..|....| ..|:.||.|:|.....||:..
 Worm   305 PDLVFTIGGNSYNVRAVEYVVNLNLPNGQCALSLFGTFSSPSG-PLWVFGDNFLRSYCHIFDFGN 368

  Fly   385 RRMGIAPAV 393
            .|:|:|.|:
 Worm   369 SRIGLAKAI 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 89/330 (27%)
Asp 88..392 CDD:278455 88/321 (27%)
asp-7NP_503826.2 Asp 60..376 CDD:365818 88/323 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162022
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D270366at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.