DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and asp-14

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_509082.2 Gene:asp-14 / 180917 WormBaseID:WBGene00019619 Length:366 Species:Caenorhabditis elegans


Alignment Length:369 Identity:86/369 - (23%)
Similarity:145/369 - (39%) Gaps:57/369 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PLRTVNAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRF 119
            |.:...||...::.|:       .:....|.|...:::|  .|.||:..||.::|..:|...|: 
 Worm    20 PFKVHAAVTNITKGGQ-------TLEQTSTFFVANLTMGTPGQLFTVVIDTSTADIVIPDMSCK- 76

  Fly   120 CIKTCGNK-FFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLK-----------IQNQ 172
            ....|.|| .|.::.|.|:.:.|..::.....|:.:|..|.|.|..||.|           :|..
 Worm    77 TANNCYNKRRFNQAKSSSYYAYGNKYTYKNNLGTFQGFDAKDTVVIGDRKTDLITIPGVKFMQAT 141

  Fly   173 GIGLVNISDSCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSDGGSMILG 237
            .:||  :.|.... |||.|..|...|.......|.|.::...:....:|..|:..:.....    
 Worm   142 DLGL--LMDGLGA-DGILGLGFTASSQIGGNSPFVQGVNAGDISGTFYSIWLEHFNQTDDL---- 199

  Fly   238 GSNSSLYYG---PL------TYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAI---MDTGTSL 290
            |::..:|||   |:      ||..:..|  ::::|...:....||.::.:.||.|   :||.|:.
 Worm   200 GTHGVIYYGGFDPVHCAPNPTYVPLASA--YAYQLTMSSFKVVGSSATNSNNKYIQTYLDTTTAQ 262

  Fly   291 IVGPVLEVLYINKDIGAEHNKTYNLY--TVACESIPQLPIIVFG-IAGKEFFVKPHTYVIRYDNF 352
            |..|...:..:...:|...|....:|  .|.|.:...|   .|| ::|....:.....||.:...
 Worm   263 IGLPKTYISQVFDSLGISTNVMNAIYPTIVPCNTKITL---TFGFVSGTTVSITERDLVISFFGT 324

  Fly   353 CFSAFM---DMLGLQYWILGDAFMRENYVEFDWARRRMGIAPAV 393
            |....:   |.:     |||....|.....||...:|:|..||:
 Worm   325 CRLQIIPTTDRI-----ILGLPLYRGRCTYFDPIMQRVGFTPAL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 80/344 (23%)
Asp 88..392 CDD:278455 79/335 (24%)
asp-14NP_509082.2 pepsin_like 44..361 CDD:133138 79/334 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.