DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and asp-17

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_741673.1 Gene:asp-17 / 180250 WormBaseID:WBGene00012683 Length:391 Species:Caenorhabditis elegans


Alignment Length:354 Identity:111/354 - (31%)
Similarity:171/354 - (48%) Gaps:36/354 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHC--RFCIKTCGN 126
            :|..:.:...|::|:.:..|..:.|..:||  .|..::..||||::.||..:.|  .||....|:
 Worm    43 ITQHAARLNTISQPISDYSDEVYLGNFTVGTPPQPVSLVLDTGSANMWVIDASCDNMFCNGWIGS 107

  Fly   127 KFFRK----SNSKSFRSSGTPFSITYGSGSVKGIVASDNVGF-GDLKIQNQGIGLVNISD---SC 183
            .:.|:    |.|.||......|||.||.|...|.:.:|.||. |.|.|:.|.:|:.|..|   :.
 Worm   108 NYTRQKFDTSKSSSFSRENRKFSIQYGKGLCSGYLGTDTVGLGGGLTIRKQELGIANKLDVDFAV 172

  Fly   184 SVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHL--KSGSSDGGS---MILGGSNSSL 243
            ...|||.|.|:..|::.:..|..|.:|.|  ::.|:||..|  |..:|.|||   :..||.::..
 Worm   173 QPMDGIFGLAWPALAVDQITPPMQNLISQ--LDVPVFSVWLDRKIQASHGGSAGMITYGGIDTKN 235

  Fly   244 YYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAE 308
            ....:||..:|...||.||:|..||   |:.|....|:.|.|||:|.|..|...:    .||..:
 Worm   236 CDAGVTYVPLTAKTYWQFKMDGFAV---GTYSQYGYNQVISDTGSSWISAPYAMI----NDIATQ 293

  Fly   309 HNKTYN----LYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRY---DNFCFSAFMDMLGLQY- 365
            .:.|::    :|||.|.::...|.:||.|.|..|.||...|::..   :..|..|...::...: 
 Worm   294 THATWDEMNEIYTVKCSTMKTQPDLVFTIGGALFPVKSVEYILDIGLDEGKCALAISPLMASGFG 358

  Fly   366 --WILGDAFMRENYVEFDWARRRMGIAPA 392
              |||||.|:|:....:|....|:|.|.|
 Worm   359 PSWILGDVFIRQYCNIYDIGNARIGFANA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 107/339 (32%)
Asp 88..392 CDD:278455 106/330 (32%)
asp-17NP_741673.1 Asp 65..387 CDD:365818 106/330 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162070
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.