DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and asp-8

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_503825.2 Gene:asp-8 / 178750 WormBaseID:WBGene00019105 Length:386 Species:Caenorhabditis elegans


Alignment Length:335 Identity:90/335 - (26%)
Similarity:149/335 - (44%) Gaps:37/335 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTC------GNKFFRKSNSKSFRSS 140
            :|..:...|.:|.  |.|.:.|||.||:.||....||  .:.|      .::.:.::.|.:|.:.
 Worm    61 FDEYYTAGVRIGTPAQHFQVAFDTTSSNLWVFGVECR--SQNCHGGRGRRDREYNRTASSTFVAG 123

  Fly   141 GTPFSITYGSGSVKGIVASDNVGFGDLKIQNQ--GIGLVNISDSCSVFDGIAGFAFQQLSMTKSV 203
            .:.|::.|..|.|.|.|..|...|....||:|  |||..........|||:.|..:...::..:.
 Worm   124 TSSFNLPYDGGHVSGNVGKDTAQFAGFTIQSQDFGIGTAATRLFGETFDGVLGLGWPATALNGTS 188

  Fly   204 PSFQQMIDQQLVEQPIF-SFHLKS---GSSDGGSMILGG-----SNSSLYYGPLTYTNVTEAKYW 259
            .:.|.::.|  ::|.:| ::..||   ..:.||.::.|.     ..|.:.|.||.|.:     :|
 Worm   189 TTMQNLLPQ--LDQKLFTTYFTKSNMHNGTAGGDIMFGAIDTTHCQSQVNYVPLAYNS-----FW 246

  Fly   260 SFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIP 324
            |:.:|..::   |:.|.......|.||.:.....|.:.:..|.|..||.::..:..||:.|.|..
 Worm   247 SYSVDGFSI---GTYSRTQTETTIPDTSSGWTGVPNVVLAGIVKATGATYDWNHQAYTLPCSSTA 308

  Fly   325 QLPIIVFGIAGKEFFVKPHTYVIRY---DNFCFSAFMDMLGLQ---YWILGDAFMRENYVEFDWA 383
            .||.:||.|.|..:.|:...||:..   :..|..:.......|   .|||||.|:|.....||:.
 Worm   309 TLPDMVFTIGGNSYNVRAVEYVVNLNLPNGQCALSLFGTAASQSGPAWILGDNFLRSYCHVFDFG 373

  Fly   384 RRRMGIAPAV 393
            ..|:|:|.|:
 Worm   374 NSRIGLAKAI 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 88/331 (27%)
Asp 88..392 CDD:278455 88/328 (27%)
asp-8NP_503825.2 pepsin_like 65..381 CDD:133138 87/327 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D270366at33208
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.