DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and CTSE

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_011507546.1 Gene:CTSE / 1510 HGNCID:2530 Length:401 Species:Homo sapiens


Alignment Length:421 Identity:141/421 - (33%)
Similarity:203/421 - (48%) Gaps:51/421 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IRVIILLFCLIVFVGGKK--VHRFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAVN 65
            ::.::||..:::.:|..:  :||..|.|.       |.....|:.|:.|..   |.....::.:.
Human     1 MKTLLLLLLVLLELGEAQGSLHRVPLRRH-------PSLKKKLRARSQLSE---FWKSHNLDMIQ 55

  Fly    66 VTSESGKGVVITEPLINSYDTNFFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRF-CIKTCGNK 127
            .|..........|||||..|..:||.:|:|.  |:||:.||||||:.||||.:|.. ..||  :.
Human    56 FTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKT--HS 118

  Fly   128 FFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDSCSV------- 185
            .|:.|.|.::...|..|||.||:||:.||:.:|.|  .....|.:|:.:|......||       
Human   119 RFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQV--SAFSYQVEGLTVVGQQFGESVTEPGQTF 181

  Fly   186 ----FDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSDG-GS-MILGGSNSSLY 244
                ||||.|..:..|::....|.|..|:.|.||:.|:||.::.|....| || :|.||.:.|.:
Human   182 VDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHF 246

  Fly   245 YGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEH 309
            .|.|.:..||:..||...||.|.|.|.....|. |.:||:|||||||.||..::..:...|||. 
Human   247 SGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSE-GCQAIVDTGTSLITGPSDKIKQLQNAIGAA- 309

  Fly   310 NKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYD-----NFCFSAFMDMLGLQ----- 364
             .....|.|.|.::..:|.:.|.|.|..:.:.|..|.: .|     .||.|.|.   ||.     
Human   310 -PVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTL-LDFVDGMQFCSSGFQ---GLDIHPPA 369

  Fly   365 --YWILGDAFMRENYVEFDWARRRMGIAPAV 393
              .|||||.|:|:.|..||....|:|:||||
Human   370 GPLWILGDVFIRQFYSVFDRGNNRVGLAPAV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 124/340 (36%)
Asp 88..392 CDD:278455 119/331 (36%)
CTSEXP_011507546.1 A1_Propeptide 21..49 CDD:285240 9/37 (24%)
Asp 77..399 CDD:278455 119/332 (36%)
Cathespin_E 78..398 CDD:133153 118/330 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151480
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.