DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Ctse

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_031825.2 Gene:Ctse / 13034 MGIID:107361 Length:397 Species:Mus musculus


Alignment Length:424 Identity:140/424 - (33%)
Similarity:192/424 - (45%) Gaps:68/424 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIILLFCLIVFVGGKKVHRFRLERRSHRHHKIPHAHLHLQFRNALR---------RKYGFTPLRT 60
            |::||..|.:......:||..|.|             |...|..||         |.:.....|.
Mouse     6 VLLLLLLLDLAQAQGALHRVPLRR-------------HQSLRKKLRAQGQLSEFWRSHNLDMTRL 57

  Fly    61 VNAVNVTSESGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKT 123
            ..:.||.|.      :.|||||..|..:||.:|:|  .|:||:.||||||:.||||.:|  ....
Mouse    58 SESCNVYSS------VNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYC--TSPA 114

  Fly   124 C-GNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIG---------LVN 178
            | .:..|..|.|.::...|..|||.||:||:.||:.:|.|....|.:..|..|         .||
Mouse   115 CKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVN 179

  Fly   179 ISDSCSVFDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKS---GSSDGGSMILGGSN 240
                 :.||||.|..:..|:.....|.|..|:.|.||..|:||.:|.|   |.| |..:..||.:
Mouse   180 -----AEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGS-GSELTFGGYD 238

  Fly   241 SSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDI 305
            .|.:.|.|.:..||:..||...||.|.| |........|.:||:|||||||.||..::..:.:.|
Mouse   239 PSHFSGSLNWIPVTKQAYWQIALDGIQV-GDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAI 302

  Fly   306 GAEHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYV----IRYDNFCFSAFMDMLGLQ-- 364
            ||  ......|.|.|.::..:|.:.|.|....:.:.|..|:    :....||.|.|.   ||.  
Mouse   303 GA--TPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQ---GLDIP 362

  Fly   365 -----YWILGDAFMRENYVEFDWARRRMGIAPAV 393
                 .|||||.|:|:.|..||....::|:||||
Mouse   363 PPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAV 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 119/338 (35%)
Asp 88..392 CDD:278455 114/329 (35%)
CtseNP_031825.2 A1_Propeptide 22..50 CDD:285240 9/40 (23%)
Asp 78..395 CDD:278455 114/330 (35%)
pepsin_retropepsin_like 79..394 CDD:299705 113/328 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.