DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Ctsd

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_034113.1 Gene:Ctsd / 13033 MGIID:88562 Length:410 Species:Mus musculus


Alignment Length:398 Identity:133/398 - (33%)
Similarity:192/398 - (48%) Gaps:75/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PLRTVNAVNVT-SESG--------KGVV----------ITEP---LINSY-DTNFFGVVSVG--D 96
            |||...::..| :|.|        ||.:          .|||   |:.:| |..::|.:.:|  .
Mouse    25 PLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPP 89

  Fly    97 QSFTMQFDTGSSDFWVPSSHCRFCIKTCG-NKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASD 160
            |.||:.||||||:.||||.||:.....|. :..:....|.::..:||.|.|.|||||:.|.::.|
Mouse    90 QCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQD 154

  Fly   161 NVGF---------GDLKIQNQ---------GIGLVNISDSCSVFDGIAGFAFQQLSMTKSVPSFQ 207
            .|..         ..:|::.|         ||..|     .:.||||.|..:..:|:...:|.|.
Mouse   155 TVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFV-----AAKFDGILGMGYPHISVNNVLPVFD 214

  Fly   208 QMIDQQLVEQPIFSFHLKSG--SSDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHG 270
            .::.|:||::.||||:|...  ...||.::|||::|..|:|.|:|.|||...||...:|.:.| |
Mouse   215 NLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEV-G 278

  Fly   271 KGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGA------EHNKTYNLYTVACESIPQLPII 329
            ......:.|.:||:||||||:||||.||..:.|.|||      |       |.:.||.:..||.:
Mouse   279 NELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGE-------YMIPCEKVSSLPTV 336

  Fly   330 VFGIAGKEFFVKPHTYVIRYD----NFCFSAFMDM-----LGLQYWILGDAFMRENYVEFDWARR 385
            ...:.||.:.:.|..|:::..    ..|.|.||.|     .| ..|||||.|:...|..||....
Mouse   337 YLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSG-PLWILGDVFIGSYYTVFDRDNN 400

  Fly   386 RMGIAPAV 393
            |:|.|.||
Mouse   401 RVGFANAV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 121/354 (34%)
Asp 88..392 CDD:278455 117/341 (34%)
CtsdNP_034113.1 A1_Propeptide 21..46 CDD:285240 6/20 (30%)
Cathepsin_D2 73..405 CDD:133157 118/345 (34%)
Asp 78..407 CDD:278455 117/342 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.980

Return to query results.
Submit another query.