DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and Pgc

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_080249.2 Gene:Pgc / 109820 MGIID:98909 Length:392 Species:Mus musculus


Alignment Length:422 Identity:126/422 - (29%)
Similarity:207/422 - (49%) Gaps:66/422 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIILLFCL------IVFVGGKKVHRFRLERRSH-------RHHKIPHAHLHLQFRNALRRKYGFT 56
            :::.|.||      ::.|..||:...|...:..       ::||....           :||.| 
Mouse     4 MVVALLCLPLLEAALIRVPLKKMKSIRETMKEQGVLKDFLKNHKYDPG-----------QKYHF- 56

  Fly    57 PLRTVNAVNVTSESGKGVVITEPLINSY-DTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCR 118
                       .:.|...|:.||:  :| |.:::|.:|:|  .|:|.:.||||||:.||.|.:|:
Mouse    57 -----------GKFGDYSVLYEPM--AYMDASYYGEISIGTPPQNFLVLFDTGSSNLWVSSVYCQ 108

  Fly   119 FCIKTCGNKFFRKSNSKSFRSSGTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDSC 183
            ....|...: :..|.|.::.:.|..||:.||:||:.|....|.:....:::.||..||.......
Mouse   109 SEACTTHTR-YNPSKSSTYYTQGQTFSLQYGTGSLTGFFGYDTLRVQSIQVPNQEFGLSENEPGT 172

  Fly   184 SV----FDGIAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKS-GSSDGGSMILGGSNSSL 243
            :.    ||||.|.|:..||...:..:.|.|:.:..:.||:|..:|.| ..|:||.::.||.:.:|
Mouse   173 NFVYAQFDGIMGLAYPGLSSGGATTALQGMLGEGALSQPLFGVYLGSQQGSNGGQIVFGGVDENL 237

  Fly   244 YYGPLTYTNVTEAKYWSFKLDFIAVHGKGSR-SSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGA 307
            |.|.||:..||:..||...:|...:..:.|. .|.:|.:.|:||||||:|.|...:..:.:.|||
Mouse   238 YTGELTWIPVTQELYWQITIDDFLIGNQASGWCSSSGCQGIVDTGTSLLVMPAQYLNELLQTIGA 302

  Fly   308 EHNKTYNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCFSAFMDMLGLQ-------- 364
            :..: |..|.|:|:|:..||.:.|.:.|.:|.:.|.:|:|:.:..|      |:||:        
Mouse   303 QEGE-YGQYFVSCDSVSSLPTLTFVLNGVQFPLSPSSYIIQEEGSC------MVGLESLSLNAES 360

  Fly   365 ---YWILGDAFMRENYVEFDWARRRMGIAPAV 393
               .|||||.|:|..|..||....|:|:||:|
Mouse   361 GQPLWILGDVFLRSYYAVFDMGNNRVGLAPSV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 109/332 (33%)
Asp 88..392 CDD:278455 106/322 (33%)
PgcNP_080249.2 A1_Propeptide 18..46 CDD:285240 4/27 (15%)
pepsin_retropepsin_like 73..391 CDD:299705 107/325 (33%)
Asp 75..390 CDD:278455 105/322 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.