DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and LOC101735147

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_031756605.1 Gene:LOC101735147 / 101735147 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:325 Identity:114/325 - (35%)
Similarity:171/325 - (52%) Gaps:25/325 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTCG-NKFFRKSNSKSFRSSGTPFSITYG 149
            ::|.:.:|  .|:||:.||||||:.||||.||......|. :..:..|.|.::..:||.|:|.||
 Frog    17 YYGEIGLGTAPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAFAIQYG 81

  Fly   150 SGSVKGIVASDNVGFGDLKIQNQGIGLV----NISDSCSVFDGIAGFAFQQLSMTKSVPSFQQMI 210
            :||:.|.::.|.|..|:|.::.|..|..    .::...:.||||.|.|:..:|:..:.|.|..::
 Frog    82 TGSLSGYLSKDTVTIGNLAVKGQIFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGAPPVFDNIM 146

  Fly   211 DQQLVEQPIFSFHLKSG--SSDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGS 273
            .|:|||..||||:|...  :..||.::|||::...|.|...|.:||...||...:|.:.| |...
 Frog   147 AQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLSVTRKAYWQIHMDQLGV-GDQL 210

  Fly   274 RSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEF 338
            ...:.|.:.|:|||||||.||:.||..:.|.|||. ......|.|.|:.:|.||:|...:.|:.:
 Frog   211 TLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAV-PLIQGQYMVQCDKVPTLPVISLTLGGQVY 274

  Fly   339 FVKPHTYVIRY----DNFCFSAFMDMLGLQ-------YWILGDAFMRENYVEFDWARRRMGIAPA 392
            .:....|:::.    ...|.|.||   ||.       .|||||.|:.:.|..||.|..|:|.|.|
 Frog   275 TLTGEQYIMKVSQLGSTICLSGFM---GLNIPPPAGPLWILGDVFIGQYYSVFDRANNRVGFAKA 336

  Fly   393  392
             Frog   337  336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 112/322 (35%)
Asp 88..392 CDD:278455 113/323 (35%)
LOC101735147XP_031756605.1 Cathepsin_D2 12..335 CDD:133157 112/322 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.