DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and LOC101733630

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_012817292.3 Gene:LOC101733630 / 101733630 -ID:- Length:343 Species:Xenopus tropicalis


Alignment Length:325 Identity:116/325 - (35%)
Similarity:170/325 - (52%) Gaps:25/325 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 FFGVVSVGD--QSFTMQFDTGSSDFWVPSSHCRFCIKTCG-NKFFRKSNSKSFRSSGTPFSITYG 149
            ::|.:.:|.  |:||:.||||||:.||||.||......|. :..:..|.|.::..:||.|:|.||
 Frog    23 YYGEIGLGSPPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAFAIQYG 87

  Fly   150 SGSVKGIVASDNVGFGDLKIQNQGIGLV----NISDSCSVFDGIAGFAFQQLSMTKSVPSFQQMI 210
            :||:.|.::.|.|..|:|.::.|..|..    .::...:.||||.|.|:..:|:....|.|..::
 Frog    88 TGSLSGYLSKDTVTIGNLAVKGQMFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGVPPVFDNIM 152

  Fly   211 DQQLVEQPIFSFHLKSG--SSDGGSMILGGSNSSLYYGPLTYTNVTEAKYWSFKLDFIAVHGKGS 273
            .|:|||..||||:|...  :..||.::|||::...|.|...|.|||...||...:|.:.| |...
 Frog   153 AQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLNVTRKAYWQIHMDQLGV-GDQL 216

  Fly   274 RSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIVFGIAGKEF 338
            ...:.|.:.|:|||||||.||:.||..:.|.|||. ......|.|.|:.:|.||:|...:.|:.:
 Frog   217 TLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAV-PLIQGQYMVQCDKVPTLPVISLTLGGQVY 280

  Fly   339 FVKPHTYVI----RYDNFCFSAFMDMLGLQ-------YWILGDAFMRENYVEFDWARRRMGIAPA 392
            .:....|::    |....|.|.||   ||.       .|||||.|:.:.|..||.|..|:|.|.|
 Frog   281 TLTGEQYIMKVSQRGSTICLSGFM---GLNIPPPAGPLWILGDVFIGQYYSVFDRAYDRVGFAKA 342

  Fly   393  392
             Frog   343  342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 114/322 (35%)
Asp 88..392 CDD:278455 115/323 (36%)
LOC101733630XP_012817292.3 Cathepsin_D2 18..341 CDD:133157 114/322 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.120

Return to query results.
Submit another query.