DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and LOC101732307

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_031751054.1 Gene:LOC101732307 / 101732307 -ID:- Length:381 Species:Xenopus tropicalis


Alignment Length:322 Identity:118/322 - (36%)
Similarity:177/322 - (54%) Gaps:15/322 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTCGNKFFRKSNSKSFRSS 140
            |||.|..|..:||.:|:|  .|.|.:.|||||::.|:||..|.....|..|:|..|.:| :|:..
 Frog    65 EPLTNYMDNQYFGTISIGTPPQEFNVVFDTGSANLWIPSVTCSSAACTNHNQFDPKLSS-TFQPG 128

  Fly   141 GTPFSITYGSGSVKGIVASDNVGFGDLKIQNQGIGLVNISDSC----SVFDGIAGFAFQQLSMTK 201
            ....||:||:||:.|.:..|.|..||:..:|||: |::.::|.    |.||||.|..:..||:..
 Frog   129 NKMVSISYGTGSMSGALGFDTVQVGDIVDRNQGL-LLSETESIFLFYSKFDGILGLGYPSLSVGD 192

  Fly   202 SVPSFQQMIDQQLVEQPIFSFHLKSGSSDGGSMILGGSNSSLYY-GPLTYTNVTEAKYWSFKLDF 265
            ..|.|..|..::|:.:.:||..|.  |..|.:::.||.:.|.:. |.|.:..||..|||...:|.
 Frog   193 VTPVFDNMWKEELINEDLFSVCLT--SHKGSAVVFGGIDGSCFAGGELQWVPVTAQKYWQITVDS 255

  Fly   266 IAVHGKGSRSSRTGNKAIMDTGTSLIVGPVLEVLYINKDIGAEHNKTYNLYTVACESIPQLPIIV 330
            :.::|: ..:.|...:||:|||||:|.|....:..|...|||:.:| |.|:||:|||:..||.|:
 Frog   256 VTINGQ-IIACRESCQAIVDTGTSVIAGHPGAIRTIQGAIGAKADK-YGLFTVSCESVSSLPEII 318

  Fly   331 FGIAGKEFFVKPHTYVIRYDNFCFSAFMDMLGLQYWILGDAFMRENYVEFDWARRRMGIAPA 392
            ..|.|..:.:....|:.::...|.|.|....|  .|||||.|:||.:..||....|:|.|||
 Frog   319 ITINGIGYPLPARAYISQFPGSCSSGFQATSG--PWILGDIFLREYFTVFDRGNNRIGFAPA 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 115/319 (36%)
Asp 88..392 CDD:278455 111/310 (36%)
LOC101732307XP_031751054.1 A1_Propeptide 16..>33 CDD:400357
pepsin_retropepsin_like 65..377 CDD:416259 115/319 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.