DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31661 and LOC100489782

DIOPT Version :9

Sequence 1:NP_722707.1 Gene:CG31661 / 33330 FlyBaseID:FBgn0051661 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_002933028.1 Gene:LOC100489782 / 100489782 -ID:- Length:383 Species:Xenopus tropicalis


Alignment Length:408 Identity:124/408 - (30%)
Similarity:204/408 - (50%) Gaps:53/408 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIILLFCLIVFVGGKKVHRFRLERRSHRHHKIPHAHLHLQFRNALRRKYGFTPLRTVNAVNVTSE 69
            :|::|.||.:..|..:|.  .::.:|.|.:......|.         ||    |:| :.::::|.
 Frog     4 LILILVCLQLSEGLVRVP--LMKSKSIRQNMAEAGVLD---------KY----LQT-HKIDLSSR 52

  Fly    70 SGKGVVITEPLINSYDTNFFGVVSVG--DQSFTMQFDTGSSDFWVPSSHCRFCIKTCGN-KFFRK 131
            .....|:||.:.  :||.::|.:|:|  .|:|.:.||||||:.|||||:|:  ...|.| ..|:.
 Frog    53 YRGYAVVTESMY--FDTYYYGPISIGTPPQNFLVLFDTGSSNLWVPSSYCQ--SSACTNHNVFKP 113

  Fly   132 SNSKSFRSSGTPFSITYGSG----SVKGIVASDNVGFGDLKIQNQGIGLVNISDSC----SVFDG 188
            |.|.::.|:|..|::.||.|    ||.|:...|.|....:.|.||..||.....:.    |.|||
 Frog   114 SQSSTYSSNGQKFTMGYGGGNVASSVTGLFGYDTVSIQGISITNQEFGLTITEPTSNFYYSPFDG 178

  Fly   189 IAGFAFQQLSMTKSVPSFQQMIDQQLVEQPIFSFHLKSGSSDGGSMILGGSNSSLYYGPLTYTNV 253
            |.|.|:..||:..:....|.|:.:.|:...:||.:|   .|..|.:|.||.:|:||.|.:.:..:
 Frog   179 ILGLAYPGLSVEGAQTVLQGMMQENLLNPSMFSIYL---GSQSGEIIFGGVDSNLYTGQIYWAPL 240

  Fly   254 TEAKYWSFKLDFIAVHGKGSRSSRTGNKAIMDTGTSLIVGP------VLEVLYINKDIGAEHNKT 312
            ::..||...|...:::|:.:.....|.:||:||||:.:..|      :|..|.|....|.     
 Frog   241 SQELYWQVALQEFSINGQATGWCSQGCQAIVDTGTTQLNIPQTYLTKLLPYLGIQTQNGG----- 300

  Fly   313 YNLYTVACESIPQLPIIVFGIAGKEFFVKPHTYVIRYDNFCFSAFMDML-----GLQYWILGDAF 372
               |.|.|.::..||.:.|.|.|..|.:.|..|:|:.:.:|::.|:::.     |...|||||.|
 Frog   301 ---YYVNCNNLQNLPTLSFTINGVSFPLPPSAYIIQENGYCYANFLNLSLPAQNGQPLWILGDVF 362

  Fly   373 MRENYVEFDWARRRMGIA 390
            :|:.|..||:...::|.|
 Frog   363 LRQYYSVFDYGNNQIGFA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31661NP_722707.1 pepsin_retropepsin_like 78..391 CDD:299705 108/335 (32%)
Asp 88..392 CDD:278455 105/325 (32%)
LOC100489782XP_002933028.1 A1_Propeptide 17..45 CDD:369623 8/43 (19%)
pepsin_retropepsin_like 66..381 CDD:386101 107/328 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.