DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and TIL

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_200615.1 Gene:TIL / 835919 AraportID:AT5G58070 Length:186 Species:Arabidopsis thaliana


Alignment Length:215 Identity:55/215 - (25%)
Similarity:92/215 - (42%) Gaps:53/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKKCI--YANYSLIDNSTVSVVNAAINRFTGQPSNV 97
            :::::...:.|.|||.|||.|::|..|: .|..:  .|.|:|..:.|:.|:|...:  .|:...:
plant     6 EMEVVKGLNVERYMGRWYEIASFPSRFQ-PKNGVDTRATYTLNPDGTIHVLNETWS--NGKRGFI 67

  Fly    98 TGQAKVLGP----GQLAVAFY-----PTQPLTKANYLVL--GTDYESYAVVYSCTSVTPLANFKI 151
            .|.|....|    .:|.|.||     |..|:| .:|.||  ..||: :|::..     |..::  
plant    68 EGSAYKADPKSDEAKLKVKFYVPPFLPIIPVT-GDYWVLYIDPDYQ-HALIGQ-----PSRSY-- 123

  Fly   152 VWILTR----QREPSAEAVDAARKILEDNDVSQAFLIDTVQKNCPRLDGNGTGLAGEDGLDVDDF 212
            :|||:|    :.|...:.|:.|  :.|..|:|:  |..|.|.:.|.                   
plant   124 LWILSRTAQMEEETYKQLVEKA--VEEGYDISK--LHKTPQSDTPP------------------- 165

  Fly   213 VSTTVPNAIEKAXEWLRRLY 232
            .|.|.|.. .|...|.:.|:
plant   166 ESNTAPED-SKGVWWFKSLF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 40/144 (28%)
TILNP_200615.1 Lipocalin_2 13..160 CDD:400495 47/162 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 1 1.000 - - FOG0002020
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101844
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1154
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.