DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and CHL

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_190370.1 Gene:CHL / 823942 AraportID:AT3G47860 Length:353 Species:Arabidopsis thaliana


Alignment Length:195 Identity:43/195 - (22%)
Similarity:71/195 - (36%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FDAEAYMGVWYEYAAYPFAFEIGK-----KCIYANYSL-IDNSTVSVVNAAINRFTGQP----SN 96
            ||...|.|.|:|.|:....| .|:     .|....|:. :..|.:.|....::   |.|    :.
plant   134 FDPVRYSGRWFEVASLKRGF-AGQGQEDCHCTQGVYTFDMKESAIRVDTFCVH---GSPDGYITG 194

  Fly    97 VTGQAKVLGPGQL----------------AVAFYPTQP-LTKANYLVLGTDYESYAVVYSCTSVT 144
            :.|:.:.:|...|                ....:||.| :.|..|.|:.|||::||:|..     
plant   195 IRGKVQCVGAEDLEKSETDLEKQEMIKEKCFLRFPTIPFIPKLPYDVIATDYDNYALVSG----- 254

  Fly   145 PLANFK-IVWILTRQREPSAEAVDAARKILEDNDVSQAFLIDTVQKNCPRLDGNGTGLAGEDGLD 208
              |..| .|.:.:|...|..|.:...:..|.........:.||.| :|...|.....:....|::
plant   255 --AKDKGFVQVYSRTPNPGPEFIAKYKNYLAQFGYDPEKIKDTPQ-DCEVTDAELAAMMSMPGME 316

  Fly   209  208
            plant   317  316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 35/149 (23%)
CHLNP_190370.1 lipocalin_FABP 126..266 CDD:415860 33/142 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.