DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and apoda.1

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001070050.2 Gene:apoda.1 / 767642 ZFINID:ZDB-GENE-060929-148 Length:185 Species:Danio rerio


Alignment Length:170 Identity:58/170 - (34%)
Similarity:89/170 - (52%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 AQVPFPGKCPDVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKKCIYANYSLIDNSTVSVVNAAINR 89
            ||||..|.||:......|:.:.:||.|:|.|..|..||.| :||..|::|..:.|..||::.|  
Zfish    17 AQVPHWGPCPEPATQPAFNLQKFMGRWFEIAKLPAQFERG-RCIETNFTLKLDGTAHVVSSEI-- 78

  Fly    90 FTGQPSNVTGQAKV---LGPGQLAVAFYPTQPLTKANYLVLGTDYESYAVVYSCTSVTPLANFKI 151
            ..|:...:.|.|.|   ..|.:|.::|....|.|.  |.:|.||||:.|:|||||.|..|.:...
Zfish    79 LKGELKTIDGTAVVEDKRNPAKLGISFSYVLPYTP--YWILSTDYENSALVYSCTDVLRLFHVDF 141

  Fly   152 VWILTRQREPSAEAVDAARKILEDNDVSQAFLIDTVQKNC 191
            .|||.|.|...|..::..:::...|::..:.:|.:.|:.|
Zfish   142 AWILGRTRSLPAATIEHGKEVFTSNNIDVSRMILSRQQGC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 46/130 (35%)
apoda.1NP_001070050.2 Lipocalin 34..178 CDD:304412 49/148 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8275
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1246
Inparanoid 1 1.050 98 1.000 Inparanoid score I5014
OMA 1 1.010 - - QHG47731
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002020
OrthoInspector 1 1.000 - - otm25092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5241
SonicParanoid 1 1.000 - - X1154
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.000

Return to query results.
Submit another query.