DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NLaz and apodb

DIOPT Version :9

Sequence 1:NP_001259867.1 Gene:NLaz / 33324 FlyBaseID:FBgn0053126 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001032784.1 Gene:apodb / 567972 ZFINID:ZDB-GENE-051023-8 Length:186 Species:Danio rerio


Alignment Length:188 Identity:71/188 - (37%)
Similarity:97/188 - (51%) Gaps:15/188 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLISVVFGAVWVAHAQVPFPGKCPDVKLLDTFDAEAYMGVWYEYAAYPFAFEIGKKCIYANYS 73
            ::.|..::|..|   .|||...|.||...:...|:.:.|:|.|||....|.:||.| |||.|||.
Zfish     5 IVFLTPLLFPLV---SAQVFRWGPCPTPMVQPNFELDKYLGKWYEIEKLPASFEKG-KCIEANYM 65

  Fly    74 LIDNSTVSVVNAAINRFTGQPSNVTGQA---KVLGPGQLAVAFYPTQPLTKANYLVLGTDYESYA 135
            |..:.||.|:|  |..:.|:.....|.|   .:..|.:|.|:|....|.  |.|.:|.|||.|.:
Zfish    66 LRPDKTVQVLN--IQTYKGKIRKAEGTAIIQDIKEPAKLGVSFSYFTPY--APYWILSTDYNSIS 126

  Fly   136 VVYSCTSVTPLANFKIVWILTRQREPSAEAVDAARKIL-EDN-DVSQAFLIDTVQKNC 191
            :|||||.|..|.:....|||:|.|...|.|:..|::|. .|| |||:.|..|  |:.|
Zfish   127 LVYSCTDVLRLFHVDYAWILSRSRFLPAGAIYHAKEIFSRDNIDVSKMFATD--QQGC 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NLazNP_001259867.1 Lipocalin 36..164 CDD:304412 49/130 (38%)
apodbNP_001032784.1 Lipocalin 35..173 CDD:304412 57/142 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 83 1.000 Domainoid score I8275
eggNOG 1 0.900 - - E1_COG3040
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1246
Inparanoid 1 1.050 98 1.000 Inparanoid score I5014
OMA 1 1.010 - - QHG47731
OrthoDB 1 1.010 - - D1631943at2759
OrthoFinder 1 1.000 - - FOG0002020
OrthoInspector 1 1.000 - - otm25092
orthoMCL 1 0.900 - - OOG6_101844
Panther 1 1.100 - - O PTHR10612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5241
SonicParanoid 1 1.000 - - X1154
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.910

Return to query results.
Submit another query.